Western Blot (WB)
(Western Blot analysis of DNAJC5G expression in transfected 293T cell line by DNAJC5G polyclonal antibody. Lane 1: DNAJC5G transfected lysate (20.79kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human DNAJC5G Polyclonal Antibody | anti-DNAJC5G antibody
DNAJC5G (DnaJ Homolog Subfamily C Member 5G, Cysteine String Protein-gamma, FLJ40417)
Gene Names
DNAJC5G; CSP-gamma
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
DNAJC5G; Polyclonal Antibody; DNAJC5G (DnaJ Homolog Subfamily C Member 5G; Cysteine String Protein-gamma; FLJ40417); Anti -DNAJC5G (DnaJ Homolog Subfamily C Member 5G; anti-DNAJC5G antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DNAJC5G.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSTVKEAAHRLSKSEMSLYAVLDLKKGASPEDFKKSYSHSALLPHPPFEYHLGRKLALRYHPDKNPGNAQAAEIFKEINAAHAILSDSKKRKIYDQHGSLGIYLYDHFGEEGVRYYFILNSCWFKTLVILCTLLTCCCFCCCCCFCCGALKPPPEQDSGRKYQQNVQSQPPRSGAKCDFRSEENSEDDF
Applicable Applications for anti-DNAJC5G antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human DNAJC5G, aa1-189 (NP_775921).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of DNAJC5G expression in transfected 293T cell line by DNAJC5G polyclonal antibody. Lane 1: DNAJC5G transfected lysate (20.79kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DNAJC5G expression in transfected 293T cell line by DNAJC5G polyclonal antibody. Lane 1: DNAJC5G transfected lysate (20.79kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DNAJC5G antibody
DNAJC5G contains 1 J domain.
Product Categories/Family for anti-DNAJC5G antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,433 Da
NCBI Official Full Name
dnaJ homolog subfamily C member 5G
NCBI Official Synonym Full Names
DnaJ (Hsp40) homolog, subfamily C, member 5 gamma
NCBI Official Symbol
DNAJC5G
NCBI Official Synonym Symbols
CSP-gamma
NCBI Protein Information
dnaJ homolog subfamily C member 5G; gamma-CSP; cysteine string protein-gamma; gamma cysteine string protein; gamma-cysteine string protein
UniProt Protein Name
DnaJ homolog subfamily C member 5G
Protein Family
UniProt Gene Name
DNAJC5G
UniProt Synonym Gene Names
CSP-gamma
UniProt Entry Name
DNJ5G_HUMAN
Uniprot Description
Subcellular location: Membrane; Lipid-anchor
By similarity.
Tissue specificity: Testis specific.
Post-translational modification: Palmitoylated
By similarity.
Sequence similarities: Contains 1 J domain.
Similar Products
Product Notes
The DNAJC5G dnajc5g (Catalog #AAA648160) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DNAJC5G (DnaJ Homolog Subfamily C Member 5G, Cysteine String Protein-gamma, FLJ40417) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJC5G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DNAJC5G dnajc5g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSTVKEAAHR LSKSEMSLYA VLDLKKGASP EDFKKSYSHS ALLPHPPFEY HLGRKLALRY HPDKNPGNAQ AAEIFKEINA AHAILSDSKK RKIYDQHGSL GIYLYDHFGE EGVRYYFILN SCWFKTLVIL CTLLTCCCFC CCCCFCCGAL KPPPEQDSGR KYQQNVQSQP PRSGAKCDFR SEENSEDDF. It is sometimes possible for the material contained within the vial of "DNAJC5G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
