Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EPB49Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DMTN Polyclonal Antibody | anti-DMTN antibody

DMTN Antibody - middle region

Gene Names
DMTN; DMT; EPB49
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DMTN; Polyclonal Antibody; DMTN Antibody - middle region; anti-DMTN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLPAYGRTTLSRLQSTEFSPSGSETGSPGLQNGEGQRGRMDRGNSLPCVL
Sequence Length
365
Applicable Applications for anti-DMTN antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EPB49
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EPB49Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EPB49Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DMTN antibody
The protein encoded by this gene is an actin binding and bundling protein that plays a structural role in erythrocytes, by stabilizing and attaching the spectrin/actin cytoskeleton to the erythrocyte membrane in a phosphorylation-dependent manner. This protein contains a core domain in the N-terminus, and a headpiece domain in the C-terminus that binds F-actin. When purified from erythrocytes, this protein exists as a trimer composed of two 48 kDa polypeptides and a 52 kDa polypeptide. The different subunits arise from alternative splicing in the 3' coding region, where the headpiece domain is located. Disruption of this gene has been correlated with the autosomal dominant Marie Unna hereditary hypotrichosis disease, while loss of heterozygosity of this gene is thought to play a role in prostate cancer progression. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-DMTN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40 kDa
NCBI Official Full Name
dematin isoform 1
NCBI Official Synonym Full Names
dematin actin binding protein
NCBI Official Symbol
DMTN
NCBI Official Synonym Symbols
DMT; EPB49
NCBI Protein Information
dematin
UniProt Protein Name
Dematin
Protein Family
UniProt Gene Name
EPB49
UniProt Synonym Gene Names
DMT
UniProt Entry Name
DEMA_HUMAN

NCBI Description

The protein encoded by this gene is an actin binding and bundling protein that plays a structural role in erythrocytes, by stabilizing and attaching the spectrin/actin cytoskeleton to the erythrocyte membrane in a phosphorylation-dependent manner. This protein contains a core domain in the N-terminus, and a headpiece domain in the C-terminus that binds F-actin. When purified from erythrocytes, this protein exists as a trimer composed of two 48 kDa polypeptides and a 52 kDa polypeptide. The different subunits arise from alternative splicing in the 3' coding region, where the headpiece domain is located. Disruption of this gene has been correlated with the autosomal dominant Marie Unna hereditary hypotrichosis disease, while loss of heterozygosity of this gene is thought to play a role in prostate cancer progression. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2014]

Uniprot Description

dematin: a probable DNA binding protein, with a Myb-like DNA-binding and ELM2 domain.

Protein type: Tumor suppressor; Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p21.1

Cellular Component: cortical cytoskeleton; perinuclear region of cytoplasm; cell projection membrane; cytoplasmic membrane-bound vesicle; plasma membrane; endomembrane system; actin filament; cytosol; actin cytoskeleton

Molecular Function: protein binding; protein self-association; spectrin binding; actin binding; receptor binding

Biological Process: regulation of cell shape; actin filament bundle formation; negative regulation of peptidyl-tyrosine phosphorylation; erythrocyte development; positive regulation of blood coagulation; actin filament capping; regulation of actin cytoskeleton organization and biogenesis; negative regulation of focal adhesion formation; negative regulation of peptidyl-serine phosphorylation; cytoskeleton organization and biogenesis; regulation of filopodium formation; protein complex assembly; actin cytoskeleton organization and biogenesis

Research Articles on DMTN

Similar Products

Product Notes

The DMTN epb49 (Catalog #AAA3221323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DMTN Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DMTN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DMTN epb49 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLPAYGRTTL SRLQSTEFSP SGSETGSPGL QNGEGQRGRM DRGNSLPCVL. It is sometimes possible for the material contained within the vial of "DMTN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.