Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DMRT1Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit DMRT1 Polyclonal Antibody | anti-DMRT1 antibody

DMRT1 Antibody - middle region

Gene Names
DMRT1; DMT1; CT154
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DMRT1; Polyclonal Antibody; DMRT1 Antibody - middle region; anti-DMRT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSY
Sequence Length
215
Applicable Applications for anti-DMRT1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DMRT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DMRT1Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DMRT1Sample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DMRT1 antibody
This is a rabbit polyclonal antibody against DMRT1. It was validated on Western Blot

Target Description: This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous.
Product Categories/Family for anti-DMRT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
doublesex- and mab-3-related transcription factor 1 isoform 1
NCBI Official Synonym Full Names
doublesex and mab-3 related transcription factor 1
NCBI Official Symbol
DMRT1
NCBI Official Synonym Symbols
DMT1; CT154
NCBI Protein Information
doublesex- and mab-3-related transcription factor 1
UniProt Protein Name
Doublesex- and mab-3-related transcription factor 1
UniProt Gene Name
DMRT1
UniProt Synonym Gene Names
DMT1
UniProt Entry Name
DMRT1_HUMAN

NCBI Description

This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. [provided by RefSeq, Jul 2008]

Uniprot Description

DMRT1: Transcription factor that plays a key role in male sex determination and differentiation by controlling testis development and male germ cell proliferation. Plays a central role in spermatogonia by inhibiting meiosis in undifferentiated spermatogonia and promoting mitosis, leading to spermatogonial development and allowing abundant and continuous production of sperm. Acts both as a transcription repressor and activator: prevents meiosis by restricting retinoic acid (RA)-dependent transcription and repressing STRA8 expression and promotes spermatogonial development by activating spermatogonial differentiation genes, such as SOHLH1. Also plays a key role in postnatal sex maintenance by maintaining testis determination and preventing feminization: represses transcription of female promoting genes such as FOXL2 and activates male-specific genes. May act as a tumor suppressor. May also play a minor role in oogenesis. Defects in DMRT1 may be a cause of testicular germ cell tumor (TGCT). A common solid malignancy in males. Germ cell tumors of the testis constitute 95% of all testicular neoplasms. Defects in DMRT1 may be a cause of 46,XY sex reversal type 4 (SRXY4). A condition characterized by male-to- female sex reversal in the presence of a normal 46,XY karyotype. Patients display complete or partial gonadal dysgenesis and a chromosome 9p deletion. Belongs to the DMRT family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 9p24.3

Cellular Component: cytoplasm; nucleus

Molecular Function: chromatin binding; metal ion binding; protein heterodimerization activity; protein homodimerization activity; transcription factor activity

Biological Process: cell morphogenesis; germ cell migration; male sex determination; male sex differentiation; negative regulation of meiosis; negative regulation of transcription from RNA polymerase II promoter; oocyte development; positive regulation of mitosis; positive regulation of transcription from RNA polymerase II promoter; Sertoli cell development; Sertoli cell differentiation; sex differentiation; spermatogenesis; transcription from RNA polymerase II promoter

Research Articles on DMRT1

Similar Products

Product Notes

The DMRT1 dmrt1 (Catalog #AAA3200327) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DMRT1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DMRT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DMRT1 dmrt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSPVKNSLRG LPGPYVPGQT GNQWQMKNME NRHAMSSQYR MHSYYPPPSY. It is sometimes possible for the material contained within the vial of "DMRT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.