Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (HumanMuscle)

Rabbit DLX2 Polyclonal Antibody | anti-DLX2 antibody

DLX2 antibody - N-terminal region

Gene Names
DLX2; TES1; TES-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
DLX2; Polyclonal Antibody; DLX2 antibody - N-terminal region; anti-DLX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP
Sequence Length
328
Applicable Applications for anti-DLX2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 87%; Dog: 92%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DLX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(HumanMuscle)

Immunohistochemistry (IHC) (HumanMuscle)

Western Blot (WB)

(Lanes:1. Mouse WT brain extract (80ug) 2. Rat brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:DLX2Submitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB) (Lanes:1. Mouse WT brain extract (80ug) 2. Rat brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:DLX2Submitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(WB Suggested Anti-DLX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-DLX2 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-DLX2 antibody
This is a rabbit polyclonal antibody against DLX2. It was validated on Western Blot and immunohistochemistry

Target Description: Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
homeobox protein DLX-2
NCBI Official Synonym Full Names
distal-less homeobox 2
NCBI Official Symbol
DLX2
NCBI Official Synonym Symbols
TES1; TES-1
NCBI Protein Information
homeobox protein DLX-2
UniProt Protein Name
Homeobox protein DLX-2
Protein Family
UniProt Gene Name
DLX2
UniProt Entry Name
DLX2_HUMAN

NCBI Description

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

DLX2: Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis. Belongs to the distal-less homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2q32

Cellular Component: nucleus

Molecular Function: single-stranded RNA binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: negative regulation of oligodendrocyte differentiation; cerebral cortex GABAergic interneuron fate commitment; branching morphogenesis of a nerve; cartilage development; olfactory bulb development; hippocampus development; regulation of transcription from RNA polymerase II promoter involved in forebrain neuron fate commitment; negative regulation of Notch signaling pathway; subpallium development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; embryonic cranial skeleton morphogenesis; brain development; proximal/distal pattern formation; odontogenesis of dentine-containing teeth

Research Articles on DLX2

Similar Products

Product Notes

The DLX2 dlx2 (Catalog #AAA3200511) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLX2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DLX2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the DLX2 dlx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTGVFDSLVA DMHSTQIAAS STYHQHQQPP SGGGAGPGGN SSSSSSLHKP. It is sometimes possible for the material contained within the vial of "DLX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.