Mouse DLX2 Monoclonal Antibody | anti-DLX2 antibody

DLX2 (Distal-less Homeobox 2, TES-1, TES1) (Biotin)

Cat. Num. AAA6171362

• Gene Names: DLX2; TES1; TES-1
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: DLX2; Monoclonal Antibody; DLX2 (Distal-less Homeobox 2; TES-1; TES1) (Biotin); Distal-less Homeobox 2; TES1; anti-DLX2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3H3
• Specificity: Recognizes DLX2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-DLX2 antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DLX2 (NP_004396, 1aa-124aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGGSPYAHMGSYQYQASGLNNVPYSAKSSYDLGYTAAYTSYAPYGT
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DLX2 is approximately 3ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DLX2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to DLX2 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-DLX2 antibody

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2. [provided by RefSeq]

Product Categories/Family for anti-DLX2 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4758168
• NCBI GeneID: 1746
• NCBI Accession #: NP_004396
• NCBI GenBank Nucleotide #: NM_004405
• UniProt Accession #: Q07687
• Molecular Weight: 34kDa
• NCBI Official Full Name: homeobox protein DLX-2
• NCBI Official Synonym Full Names: distal-less homeobox 2
• NCBI Official Symbol: DLX2
• NCBI Official Synonym Symbols: TES1; TES-1
• NCBI Protein Information: homeobox protein DLX-2
• UniProt Protein Name: Homeobox protein DLX-2
• Protein Family: Homeobox protein
• UniProt Gene Name: DLX2
• UniProt Entry Name: DLX2_HUMAN

NCBI Description

Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

DLX2: Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis. Belongs to the distal-less homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2q32

Cellular Component: nucleus

Molecular Function: single-stranded RNA binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: negative regulation of oligodendrocyte differentiation; cerebral cortex GABAergic interneuron fate commitment; branching morphogenesis of a nerve; cartilage development; olfactory bulb development; hippocampus development; regulation of transcription from RNA polymerase II promoter involved in forebrain neuron fate commitment; negative regulation of Notch signaling pathway; subpallium development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; embryonic cranial skeleton morphogenesis; brain development; proximal/distal pattern formation; odontogenesis of dentine-containing teeth