Western Blot (WB)
(Host: MouseTarget Name: DLG4Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Rabbit DLG4 Polyclonal Antibody | anti-DLG4 antibody
DLG4 antibody - middle region
Gene Names
DLG4; PSD95; SAP90; SAP-90
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DLG4; Polyclonal Antibody; DLG4 antibody - middle region; anti-DLG4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS
Sequence Length
767
Applicable Applications for anti-DLG4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 79%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DLG4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: DLG4Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: DLG4Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DLG4Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DLG4Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-DLG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)
Western Blot (WB)
(WB Suggested Anti-DLG4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysate)
Related Product Information for anti-DLG4 antibody
This is a rabbit polyclonal antibody against DLG4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-DLG4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
disks large homolog 4 isoform 1
NCBI Official Synonym Full Names
discs large MAGUK scaffold protein 4
NCBI Official Symbol
DLG4
NCBI Official Synonym Symbols
PSD95; SAP90; SAP-90
NCBI Protein Information
disks large homolog 4
UniProt Protein Name
Disks large homolog 4
Protein Family
UniProt Gene Name
DLG4
UniProt Synonym Gene Names
PSD95; PSD-95; SAP-90; SAP90
UniProt Entry Name
DLG4_HUMAN
NCBI Description
This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on DLG4
Similar Products
Product Notes
The DLG4 dlg4 (Catalog #AAA3210243) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLG4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DLG4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DLG4 dlg4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAHLHPIAIF IRPRSLENVL EINKRITEEQ ARKAFDRATK LEQEFTECFS. It is sometimes possible for the material contained within the vial of "DLG4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
