Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DKK3Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human DKK3 Polyclonal Antibody | anti-DKK3 antibody

DKK3 Antibody - middle region

Gene Names
DKK3; RIG; REIC
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DKK3; Polyclonal Antibody; DKK3 Antibody - middle region; anti-DKK3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGR
Sequence Length
142
Applicable Applications for anti-DKK3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DKK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DKK3Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DKK3Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DKK3 antibody
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein.
Product Categories/Family for anti-DKK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
dickkopf-related protein 3 isoform 1
NCBI Official Synonym Full Names
dickkopf WNT signaling pathway inhibitor 3
NCBI Official Symbol
DKK3
NCBI Official Synonym Symbols
RIG; REIC
NCBI Protein Information
dickkopf-related protein 3
UniProt Protein Name
Dickkopf-related protein 3
Protein Family
UniProt Gene Name
DKK3
UniProt Synonym Gene Names
REIC; Dickkopf-3; Dkk-3; hDkk-3
UniProt Entry Name
DKK3_HUMAN

NCBI Description

This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

DKK3: Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero- posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Belongs to the dickkopf family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11p15.2

Cellular Component: extracellular space

Biological Process: anatomical structure morphogenesis; Wnt receptor signaling pathway; adrenal gland development; negative regulation of aldosterone biosynthetic process; negative regulation of transcription, DNA-dependent

Research Articles on DKK3

Similar Products

Product Notes

The DKK3 dkk3 (Catalog #AAA3220631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DKK3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DKK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DKK3 dkk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SYHNETNTDT KVGNNTIHVH REIHKITNNQ TGQMVFSETV ITSVGDEEGR. It is sometimes possible for the material contained within the vial of "DKK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.