Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DIRAS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit DIRAS1 Polyclonal Antibody | anti-DIRAS1 antibody

DIRAS1 antibody - middle region

Gene Names
DIRAS1; RIG; GBTS1; Di-Ras1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DIRAS1; Polyclonal Antibody; DIRAS1 antibody - middle region; anti-DIRAS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK
Sequence Length
198
Applicable Applications for anti-DIRAS1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 79%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DIRAS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DIRAS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-DIRAS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-DIRAS1 antibody
This is a rabbit polyclonal antibody against DIRAS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DIRAS1 belongs to a distinct branch of the functionally diverse Ras superfamily of monomeric GTPases. DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM]. Sequence Note: removed 1 base from the 5' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3390 BC030660.1 2-3391
Product Categories/Family for anti-DIRAS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
GTP-binding protein Di-Ras1
NCBI Official Synonym Full Names
DIRAS family GTPase 1
NCBI Official Symbol
DIRAS1
NCBI Official Synonym Symbols
RIG; GBTS1; Di-Ras1
NCBI Protein Information
GTP-binding protein Di-Ras1
UniProt Protein Name
GTP-binding protein Di-Ras1
Protein Family
UniProt Gene Name
DIRAS1
UniProt Synonym Gene Names
GBTS1; RIG; Rig
UniProt Entry Name
DIRA1_HUMAN

NCBI Description

DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004]

Uniprot Description

DIRAS1: Displays low GTPase activity and exist predominantly in the GTP-bound form. Belongs to the small GTPase superfamily. Di-Ras family.

Protein type: G protein, monomeric, di-Ras; G protein; G protein, monomeric

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: plasma membrane

Molecular Function: GTPase activity; GTP binding; mitogen-activated protein kinase binding

Biological Process: positive regulation of MAP kinase activity; metabolic process; small GTPase mediated signal transduction

Research Articles on DIRAS1

Similar Products

Product Notes

The DIRAS1 diras1 (Catalog #AAA3210987) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DIRAS1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DIRAS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DIRAS1 diras1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCAFMETSAK MNYNVKELFQ ELLTLETRRN MSLNIDGKRS GKQKRTDRVK. It is sometimes possible for the material contained within the vial of "DIRAS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.