Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Pancreas )

Rabbit DHX9 Polyclonal Antibody | anti-DHX9 antibody

DHX9 antibody - N-terminal region

Gene Names
DHX9; LKP; RHA; DDX9; NDH2; NDHII
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
DHX9; Polyclonal Antibody; DHX9 antibody - N-terminal region; anti-DHX9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
Sequence Length
1279
Applicable Applications for anti-DHX9 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Pancreas )

Immunohistochemistry (IHC) (Human Pancreas )

Western Blot (WB)

(WB Suggested Anti-DHX9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-DHX9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-DHX9 antibody
This is a rabbit polyclonal antibody against DHX9. It was validated on Western Blot and immunohistochemistry

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
ATP-dependent RNA helicase A
NCBI Official Synonym Full Names
DExH-box helicase 9
NCBI Official Symbol
DHX9
NCBI Official Synonym Symbols
LKP; RHA; DDX9; NDH2; NDHII
NCBI Protein Information
ATP-dependent RNA helicase A
UniProt Protein Name
ATP-dependent RNA helicase A
UniProt Gene Name
DHX9
UniProt Synonym Gene Names
DDX9; LKP; NDH2; RHA; LKP; NDH II
UniProt Entry Name
DHX9_HUMAN

NCBI Description

This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.[provided by RefSeq, Feb 2010]

Uniprot Description

DDX9: a helicase that unwinds double-stranded DNA and RNA in a 3' to 5' direction. Interacts with the RNA-induced silencing complex (RISC) in human cells and functions in RISC loading. Generates multiple secondary structures that influence RNA-binding proteins. Has a dsRNA binding motif at the N-terminus, RGG-box at the carboxyl terminus, and a bidirectional nuclear transport domain of 110 amino acids at the carboxyl terminus. May play a role in X-linked gene expression.

Protein type: Nuclear receptor co-regulator; Spliceosome; Nucleolus; Helicase; RNA splicing; EC 3.6.4.13; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: nucleoplasm; centrosome; membrane; cytoplasm; nucleolus; nucleus; ribonucleoprotein complex; cytosol

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; ATP-dependent RNA helicase activity; ATP binding; RNA helicase activity

Biological Process: osteoblast differentiation; circadian rhythm; RNA processing; nuclear mRNA splicing, via spliceosome; RNA splicing; positive regulation of interferon type I production; innate immune response; gene expression; DNA duplex unwinding

Research Articles on DHX9

Similar Products

Product Notes

The DHX9 dhx9 (Catalog #AAA3203086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHX9 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHX9 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the DHX9 dhx9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLHGNWTLEN AKARLNQYFQ KEKIQGEYKY TQVGPDHNRS FIAEMTIYIK. It is sometimes possible for the material contained within the vial of "DHX9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.