Western Blot (WB)
(Host: RabbitTarget Name: DHRS12Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Rabbit DHRS12 Polyclonal Antibody | anti-DHRS12 antibody
DHRS12 Antibody - middle region
Gene Names
DHRS12; SDR40C1
Reactivity
Cow, Human, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DHRS12; Polyclonal Antibody; DHRS12 Antibody - middle region; anti-DHRS12 antibody
Host
Rabbit
Reactivity
Cow, Human, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVL
Sequence Length
271
Applicable Applications for anti-DHRS12 antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human DHRS12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DHRS12Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DHRS12Sample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-DHRS12 antibody
This is a rabbit polyclonal antibody against DHRS12. It was validated on Western Blot
Target Description: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Alternative splicing results in multiple transcript variants and protein isoforms.
Target Description: This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Alternative splicing results in multiple transcript variants and protein isoforms.
Product Categories/Family for anti-DHRS12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
dehydrogenase/reductase SDR family member 12 isoform 2
NCBI Official Synonym Full Names
dehydrogenase/reductase 12
NCBI Official Symbol
DHRS12
NCBI Official Synonym Symbols
SDR40C1
NCBI Protein Information
dehydrogenase/reductase SDR family member 12
UniProt Protein Name
Dehydrogenase/reductase SDR family member 12
Protein Family
UniProt Gene Name
DHRS12
UniProt Entry Name
DHR12_HUMAN
NCBI Description
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012]
Similar Products
Product Notes
The DHRS12 dhrs12 (Catalog #AAA3218390) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHRS12 Antibody - middle region reacts with Cow, Human, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DHRS12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DHRS12 dhrs12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FKQEHKLHVL INNAGCMVNK RELTEDGLEK NFAANTLGVY ILTTGLIPVL. It is sometimes possible for the material contained within the vial of "DHRS12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
