Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DHRS1 polyclonal antibody. Western Blot analysis of DHRS1 expression in human liver.)

Mouse anti-Human DHRS1 Polyclonal Antibody | anti-DHRS1 antibody

DHRS1 (Dehydrogenase/Reductase SDR Family Member 1, DKFZp586I0523, FLJ14250, FLJ25430, MGC20204, SDR19C1)

Gene Names
DHRS1; SDR19C1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DHRS1; Polyclonal Antibody; DHRS1 (Dehydrogenase/Reductase SDR Family Member 1; DKFZp586I0523; FLJ14250; FLJ25430; MGC20204; SDR19C1); Anti -DHRS1 (Dehydrogenase/Reductase SDR Family Member 1; anti-DHRS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DHRS1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF
Applicable Applications for anti-DHRS1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human DHRS1, aa1-313 (NP_612461.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DHRS1 polyclonal antibody. Western Blot analysis of DHRS1 expression in human liver.)

Western Blot (WB) (DHRS1 polyclonal antibody. Western Blot analysis of DHRS1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of DHRS1 expression in transfected 293T cell line by DHRS1 polyclonal antibody. Lane 1: DHRS1 transfected lysate (34.43kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DHRS1 expression in transfected 293T cell line by DHRS1 polyclonal antibody. Lane 1: DHRS1 transfected lysate (34.43kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DHRS1 antibody
This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-DHRS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,909 Da
NCBI Official Full Name
dehydrogenase/reductase SDR family member 1
NCBI Official Synonym Full Names
dehydrogenase/reductase (SDR family) member 1
NCBI Official Symbol
DHRS1
NCBI Official Synonym Symbols
SDR19C1
NCBI Protein Information
dehydrogenase/reductase SDR family member 1; short chain dehydrogenase/reductase family 19C, member 1
UniProt Protein Name
Dehydrogenase/reductase SDR family member 1
UniProt Gene Name
DHRS1
UniProt Entry Name
DHRS1_HUMAN

NCBI Description

This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008]

Uniprot Description

Tissue specificity: Detected in heart and liver, and at low levels in skeletal muscle, kidney and pancreas. Ref.1

Sequence similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Research Articles on DHRS1

Similar Products

Product Notes

The DHRS1 dhrs1 (Catalog #AAA645816) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHRS1 (Dehydrogenase/Reductase SDR Family Member 1, DKFZp586I0523, FLJ14250, FLJ25430, MGC20204, SDR19C1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHRS1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DHRS1 dhrs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAPMNGQVC VVTGASRGIG RGIALQLCKA GATVYITGRH LDTLRVVAQE AQSLGGQCVP VVCDSSQESE VRSLFEQVDR EQQGRLDVLV NNAYAGVQTI LNTRNKAFWE TPASMWDDIN NVGLRGHYFC SVYGARLMVP AGQGLIVVIS SPGSLQYMFN VPYGVGKAAC DKLAADCAHE LRRHGVSCVS LWPGIVQTEL LKEHMAKEEV LQDPVLKQFK SAFSSAETTE LSGKCVVALA TDPNILSLSG KVLPSCDLAR RYGLRDVDGR PVQDYLSLSS VLSHVSGLGW LASYLPSFLR VPKWIIALYT SKF. It is sometimes possible for the material contained within the vial of "DHRS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.