Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DGAT2L4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

Rabbit DGAT2L4 Polyclonal Antibody | anti-AWAT2 antibody

DGAT2L4 antibody - C-terminal region

Gene Names
AWAT2; WS; DC4; ARAT; MFAT; DGAT2L4
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DGAT2L4; Polyclonal Antibody; DGAT2L4 antibody - C-terminal region; anti-AWAT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GEPLPMPKIENPSQEIVAKYHTLYIDALRKLFDQHKTKFGISETQELEII
Sequence Length
333
Applicable Applications for anti-AWAT2 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DGAT2L4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DGAT2L4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-DGAT2L4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)
Related Product Information for anti-AWAT2 antibody
This is a rabbit polyclonal antibody against DGAT2L4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DGAT2L4 is acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. It has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols. DGAT2L4 may also have 2-acylglycerol O-acyltransferase (MGAT) and acyl-CoA:retinol acyltransferase (ARAT) activities, to catalyze the synthesis of diacylglycerols and retinyl esters, however this activity is unclear in vivo.
Product Categories/Family for anti-AWAT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
acyl-CoA wax alcohol acyltransferase 2
NCBI Official Synonym Full Names
acyl-CoA wax alcohol acyltransferase 2
NCBI Official Symbol
AWAT2
NCBI Official Synonym Symbols
WS; DC4; ARAT; MFAT; DGAT2L4
NCBI Protein Information
acyl-CoA wax alcohol acyltransferase 2
UniProt Protein Name
Acyl-CoA wax alcohol acyltransferase 2
UniProt Gene Name
AWAT2
UniProt Synonym Gene Names
DC4; DGAT2L4; MFAT; WS; ARAT; Retinol O-fatty-acyltransferase; hDC4; hWS
UniProt Entry Name
AWAT2_HUMAN

NCBI Description

This gene encodes an enzyme belonging to the diacylglycerol acyltransferase family. This enzyme produces wax esters by the esterification of long chain (or wax) alcohols with acyl-CoA-derived fatty acids. It functions in lipid metabolism in the skin, mostly in undifferentiated peripheral sebocytes. This enzyme may also have acyl-CoA:retinol acyltransferase activities, where it catalyzes the synthesis of diacylglycerols and retinyl esters. [provided by RefSeq, May 2010]

Uniprot Description

DGAT2L4: Acyltransferase that predominantly esterify long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that it plays a central role in lipid metabolism in skin. Has no activity using decyl alcohol and significantly prefers the C16 and C18 alcohols. May also have 2-acylglycerol O-acyltransferase (MGAT) and acyl- CoA:retinol acyltransferase (ARAT) activities, to catalyze the synthesis of diacylglycerols and retinyl esters; however this activity is unclear in vivo. Belongs to the diacylglycerol acyltransferase family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Cofactor and Vitamin Metabolism - retinol; EC 2.3.1.75; EC 2.3.1.76; Lipid Metabolism - glycerolipid; Transferase

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: retinol O-fatty-acyltransferase activity; long-chain-alcohol O-fatty-acyltransferase activity

Biological Process: retinol metabolic process; wax biosynthetic process

Research Articles on AWAT2

Similar Products

Product Notes

The AWAT2 awat2 (Catalog #AAA3207361) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGAT2L4 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DGAT2L4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AWAT2 awat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GEPLPMPKIE NPSQEIVAKY HTLYIDALRK LFDQHKTKFG ISETQELEII. It is sometimes possible for the material contained within the vial of "DGAT2L4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.