Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DCUN1D1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Human, Mouse DCUN1D1 Polyclonal Antibody | anti-DCUN1D1 antibody
DCUN1D1 Polyclonal Antibody
Gene Names
DCUN1D1; RP42; SCRO; Tes3; DCNL1; SCCRO; DCUN1L1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DCUN1D1; Polyclonal Antibody; DCUN1D1 Polyclonal Antibody; DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3; anti-DCUN1D1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
FMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN
Sequence Length
244
Applicable Applications for anti-DCUN1D1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human DCUN1D1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
A-549, Mouse testis, Mouse heart
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DCUN1D1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DCUN1D1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Product Categories/Family for anti-DCUN1D1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 30kDa
Observed: 30kDa
Observed: 30kDa
NCBI Official Full Name
DCN1-like protein 1 isoform 2
NCBI Official Synonym Full Names
defective in cullin neddylation 1 domain containing 1
NCBI Official Symbol
DCUN1D1
NCBI Official Synonym Symbols
RP42; SCRO; Tes3; DCNL1; SCCRO; DCUN1L1
NCBI Protein Information
DCN1-like protein 1
UniProt Protein Name
DCN1-like protein 1
Protein Family
UniProt Gene Name
DCUN1D1
UniProt Synonym Gene Names
DCUN1L1; RP42; SCCRO
Uniprot Description
Part of an E3 ubiquitin ligase complex for neddylation. Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes. Acts by binding to cullin-RBX1 complexes in the cytoplasm and promoting their nuclear translocation, enhancing recruitment of E2-NEDD8 (UBE2M-NEDD8) thioester to the complex, and optimizing the orientation of proteins in the complex to allow efficient transfer of NEDD8 from the E2 to the cullin substrates (PubMed:25349211). Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression ().
Research Articles on DCUN1D1
Similar Products
Product Notes
The DCUN1D1 dcun1d1 (Catalog #AAA9134588) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCUN1D1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DCUN1D1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the DCUN1D1 dcun1d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FMIFTQSSEK TAVSCLSQND WKLDVATDNF FQNPELYIRE SVKGSLDRKK LEQLYN. It is sometimes possible for the material contained within the vial of "DCUN1D1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
