Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IQWD1Sample Type: OVCAR-3 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit DCAF6 Polyclonal Antibody | anti-DCAF6 antibody

DCAF6 Antibody - C-terminal region

Gene Names
DCAF6; NRIP; ARCAP; IQWD1; PC326; MSTP055; 1200006M05Rik
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DCAF6; Polyclonal Antibody; DCAF6 Antibody - C-terminal region; anti-DCAF6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMLEETRNTITVPASFMLRMLASLNHIRADRLEGDRSEGSGQENENEDEE
Sequence Length
533
Applicable Applications for anti-DCAF6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human DCAF6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IQWD1Sample Type: OVCAR-3 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IQWD1Sample Type: OVCAR-3 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-DCAF6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
DDB1- and CUL4-associated factor 6 isoform b
NCBI Official Synonym Full Names
DDB1 and CUL4 associated factor 6
NCBI Official Symbol
DCAF6
NCBI Official Synonym Symbols
NRIP; ARCAP; IQWD1; PC326; MSTP055; 1200006M05Rik
NCBI Protein Information
DDB1- and CUL4-associated factor 6
UniProt Protein Name
DDB1- and CUL4-associated factor 6
UniProt Gene Name
DCAF6
UniProt Synonym Gene Names
IQWD1; ARCAP; NRIP
UniProt Entry Name
DCAF6_HUMAN

NCBI Description

The protein encoded by this gene is a ligand-dependent coactivator of nuclear receptors, including nuclear receptor subfamily 3 group C member 1 (NR3C1), glucocorticoid receptor (GR), and androgen receptor (AR). The encoded protein and DNA damage binding protein 2 (DDB2) may act as tumor promoters and tumor suppressors, respectively, by regulating the level of androgen receptor in prostate tissues. In addition, this protein can act with glucocorticoid receptor to promote human papillomavirus gene expression. [provided by RefSeq, Mar 2017]

Uniprot Description

MSTP055: Ligand-dependent coactivator of nuclear receptors. Enhance transcriptional activity of the nuclear receptors NR3C1 and AR. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: nucleoplasm; focal adhesion; cytoplasm; nucleus

Molecular Function: ligand-dependent nuclear receptor transcription coactivator activity

Biological Process: protein ubiquitination; positive regulation of transcription from RNA polymerase II promoter

Research Articles on DCAF6

Similar Products

Product Notes

The DCAF6 dcaf6 (Catalog #AAA3219361) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCAF6 Antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DCAF6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCAF6 dcaf6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMLEETRNTI TVPASFMLRM LASLNHIRAD RLEGDRSEGS GQENENEDEE. It is sometimes possible for the material contained within the vial of "DCAF6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.