Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DBN1Sample Tissue: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human DBN1 Polyclonal Antibody | anti-DBN1 antibody

DBN1 Antibody - middle region

Gene Names
DBN1; D0S117E
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DBN1; Polyclonal Antibody; DBN1 Antibody - middle region; anti-DBN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAAIIAQRPDNPREFFKQQERVASASAGSCDVPSPFNHRPGSHLDSHRRM
Sequence Length
649
Applicable Applications for anti-DBN1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DBN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DBN1Sample Tissue: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DBN1Sample Tissue: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DBN1 antibody
The protein encoded by this gene is a cytoplasmic actin-binding protein thought to play a role in the process of neuronal growth. It is a member of the drebrin family of proteins that are developmentally regulated in the brain. A decrease in the amount of this protein in the brain has been implicated as a possible contributing factor in the pathogenesis of memory disturbance in Alzheimer's disease. At least two alternative splice variants encoding different protein isoforms have been described for this gene.
Product Categories/Family for anti-DBN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71 kDa
NCBI Official Full Name
drebrin isoform a
NCBI Official Synonym Full Names
drebrin 1
NCBI Official Symbol
DBN1
NCBI Official Synonym Symbols
D0S117E
NCBI Protein Information
drebrin
UniProt Protein Name
Drebrin
Protein Family
UniProt Gene Name
DBN1
UniProt Synonym Gene Names
D0S117E
UniProt Entry Name
DREB_HUMAN

NCBI Description

The protein encoded by this gene is a cytoplasmic actin-binding protein thought to play a role in the process of neuronal growth. It is a member of the drebrin family of proteins that are developmentally regulated in the brain. A decrease in the amount of this protein in the brain has been implicated as a possible contributing factor in the pathogenesis of memory disturbance in Alzheimer's disease. At least two alternative splice variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DBN1: a cytoplasmic actin-binding protein thought to play a role in the process of neuronal growth. It is a member of the drebrin family of proteins that are developmentally regulated in the brain. A decrease in the amount of this protein in the brain has been implicated as a possible contributing factor in the pathogenesis of memory disturbance in Alzheimer's disease. Expressed in brain neurons, heart, placenta, skeletal muscle, kidney and pancreas. Two alternatively spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; Actin-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: cytoplasm; dendrite; plasma membrane; gap junction; actomyosin; cell cortex; actin cytoskeleton

Molecular Function: protein binding; actin binding; profilin binding

Biological Process: maintenance of cellular protein localization; regulation of dendrite development; actin filament organization; regulation of neuronal synaptic plasticity

Research Articles on DBN1

Similar Products

Product Notes

The DBN1 dbn1 (Catalog #AAA3220944) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBN1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DBN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DBN1 dbn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAIIAQRPD NPREFFKQQE RVASASAGSC DVPSPFNHRP GSHLDSHRRM. It is sometimes possible for the material contained within the vial of "DBN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.