Western Blot (WB)
(Western Blot analysis of DARS2 expression in transfected 293T cell line by DARS2 polyclonal antibody. Lane 1: DARS2 transfected lysate (73.6kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human DARS2 Polyclonal Antibody | anti-DARS2 antibody
DARS2 (Aspartyl-tRNA Synthetase, Mitochondrial, Aspartate-tRNA Ligase, AspRS) (PE)
Gene Names
DARS2; LBSL; ASPRS; MT-ASPRS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DARS2; Polyclonal Antibody; DARS2 (Aspartyl-tRNA Synthetase; Mitochondrial; Aspartate-tRNA Ligase; AspRS) (PE); anti-DARS2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DARS2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-DARS2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DARS2, aa1-645 (NP_060592.2).
Immunogen Sequence
MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSSHLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRSFQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of DARS2 expression in transfected 293T cell line by DARS2 polyclonal antibody. Lane 1: DARS2 transfected lysate (73.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of DARS2 expression in transfected 293T cell line by DARS2 polyclonal antibody. Lane 1: DARS2 transfected lysate (73.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DARS2 antibody
Aspartyl-tRNA synthetase (DARS) is part of a multienzyme complex of aminoacyl-tRNA synthetases. Aspartyl-tRNA synthetase charges its cognate tRNA with aspartate during protein biosynthesis. Defects in DARS2 are a cause of leukoencephalopathy with brainstem and spinal cord involvement and lactate elevation (LBSL). LBSL is an autosomal recessive disease and is defined on the basis of a highly characteristic constellation of abnormalities observed by magnetic resonance imaging and spectroscopy. Affected individuals develop slowly progressive cerebellar ataxia, spasticity, and dorsal column dysfunction, sometimes with a mild cognitive deficit or decline.
Product Categories/Family for anti-DARS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,563 Da
NCBI Official Full Name
aspartate--tRNA ligase, mitochondrial
NCBI Official Synonym Full Names
aspartyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
DARS2
NCBI Official Synonym Symbols
LBSL; ASPRS; MT-ASPRS
NCBI Protein Information
aspartate--tRNA ligase, mitochondrial; aspartate tRNA ligase 2, mitochondrial; aspartyl-tRNA synthetase, mitochondrial
UniProt Protein Name
Aspartate--tRNA ligase, mitochondrial
UniProt Gene Name
DARS2
UniProt Synonym Gene Names
AspRS
UniProt Entry Name
SYDM_HUMAN
Uniprot Description
DARS2: Defects in DARS2 are a cause of leukoencephalopathy with brainstem and spinal cord involvement and lactate elevation (LBSL). LBSL is an autosomal recessive disease and is defined on the basis of a highly characteristic constellation of abnormalities observed by magnetic resonance imaging and spectroscopy. Affected individuals develop slowly progressive cerebellar ataxia, spasticity, and dorsal column dysfunction, sometimes with a mild cognitive deficit or decline. Belongs to the class-II aminoacyl-tRNA synthetase family.
Protein type: Ligase; Translation; EC 6.1.1.12; Mitochondrial
Chromosomal Location of Human Ortholog: 1q25.1
Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; nucleus
Molecular Function: protein binding; protein homodimerization activity; aspartate-tRNA ligase activity; aspartate-tRNA(Asn) ligase activity; ATP binding; tRNA binding
Biological Process: tRNA aminoacylation for protein translation; gene expression; tRNA aminoacylation
Disease: Leukoencephalopathy With Brainstem And Spinal Cord Involvement And Lactate Elevation
Similar Products
Product Notes
The DARS2 dars2 (Catalog #AAA6375654) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DARS2 (Aspartyl-tRNA Synthetase, Mitochondrial, Aspartate-tRNA Ligase, AspRS) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DARS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DARS2 dars2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DARS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
