Rabbit DAP Polyclonal Antibody | anti-DAP antibody

DAP antibody - middle region

Cat. Num. AAA3214684

• Reactivity: Cow, Guinea Pig, Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified
• Synonyms: DAP; Polyclonal Antibody; DAP antibody - middle region; anti-DAP antibody

• Host: Rabbit
• Reactivity: Cow, Guinea Pig, Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQ
• Sequence Length: 102

• Applicable Applications for anti-DAP antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Homology: Cow: 92%; Guinea Pig: 85%; Human: 100%; Mouse: 93%; Rat: 100%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-DAP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart TissueObserved Staining: Cytoplasm in cardiomyocytes and endothelial cells in capillariesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-DAP AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)

Related Product Information for anti-DAP antibody

This is a rabbit polyclonal antibody against DAP. It was validated on Western Blot

Target Description: This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma.

Product Categories/Family for anti-DAP antibody

Polyclonal; Transcription Regulation; Various; Tissue Specific & Cell Marker; Autophagy; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 4758120
• NCBI GeneID: 1611
• NCBI Accession #: NP_004385
• NCBI GenBank Nucleotide #: NM_004394
• UniProt Accession #: P51397
• Molecular Weight: 11kDa
• NCBI Official Full Name: death-associated protein 1 isoform 2
• NCBI Official Synonym Full Names: death associated protein
• NCBI Official Symbol: DAP
• NCBI Protein Information: death-associated protein 1
• UniProt Protein Name: Death-associated protein 1
• Protein Family: Dapper
• UniProt Gene Name: DAP
• UniProt Synonym Gene Names: DAP1; DAP-1
• UniProt Entry Name: DAP1_HUMAN

NCBI Description

This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]

Uniprot Description

DAP: a 15 kDa, proline rich protein that possesses one SH3 binding motif. Negatively regulates autophagy and is involved in mediating interferon-gamma-induced cell death. Localizes in the cytoplasm, but the detailed mechanism of its proapoptotic function is unclear.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 5p15.2

Biological Process: apoptosis; caspase activation; cellular response to amino acid starvation; inhibition of NF-kappaB transcription factor; negative regulation of autophagy; negative regulation of transcription, DNA-dependent