Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DACT1 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Rabbit DACT1 Polyclonal Antibody | anti-DACT1 antibody

DACT1 antibody - N-terminal region

Gene Names
DACT1; DPR1; TBS2; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DACT1; Polyclonal Antibody; DACT1 antibody - N-terminal region; anti-DACT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRLDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCH
Sequence Length
836
Applicable Applications for anti-DACT1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DACT1 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)

Western Blot (WB) (WB Suggested Anti-DACT1 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole Cell)
Related Product Information for anti-DACT1 antibody
This is a rabbit polyclonal antibody against DACT1. It was validated on Western Blot

Target Description: DACT1 positively regulates DVL2-mediated signaling pathways during development. It binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway.
Product Categories/Family for anti-DACT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
dapper homolog 1 isoform 1
NCBI Official Synonym Full Names
dishevelled binding antagonist of beta catenin 1
NCBI Official Symbol
DACT1
NCBI Official Synonym Symbols
DPR1; TBS2; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
NCBI Protein Information
dapper homolog 1
UniProt Protein Name
Dapper homolog 1
Protein Family
UniProt Gene Name
DACT1
UniProt Synonym Gene Names
DPR1; HNG3; hDPR1
UniProt Entry Name
DACT1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the dapper family, characterized by the presence of PDZ-binding motif at the C-terminus. It interacts with, and positively regulates dishevelled-mediated signaling pathways during development. Depletion of this mRNA from xenopus embryos resulted in loss of notochord and head structures, and mice lacking this gene died shortly after birth from severe posterior malformations. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

DACT1: Positively regulates DVL2-mediated signaling pathways during development. Binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway. Interacts with DVL1 and DVL2. Belongs to the dapper family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: nucleoplasm; cytoplasm; synapse; cell junction; beta-catenin destruction complex; cytosol

Molecular Function: protein binding; protein kinase C binding; protein kinase A binding; beta-catenin binding

Biological Process: negative regulation of JNK cascade; negative regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; dendrite morphogenesis; positive regulation of protein catabolic process; synapse organization and biogenesis; positive regulation of fat cell differentiation; regulation of protein stability; gastrulation with mouth forming second; negative regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; embryonic hindgut morphogenesis

Research Articles on DACT1

Similar Products

Product Notes

The DACT1 dact1 (Catalog #AAA3215742) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DACT1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DACT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DACT1 dact1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRLDVEKTSE EHLETDSRPS SGFYELSDGA SGSLSNSSNS VFSECLSSCH. It is sometimes possible for the material contained within the vial of "DACT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.