Mouse DACT1 Monoclonal Antibody | anti-DACT1 antibody

DACT1 (Capper, Antagonist of beta-Catenin, Homolog 1 (Xenopus laevis), DAPPER, DAPPER1, DPR1, FRODO, HDPR1, THYEX3) (Biotin)

Cat. Num. AAA6174496

• Gene Names: DACT1; DPR1; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
• Applications: Western Blot
• Purity: Purified
• Synonyms: DACT1; Monoclonal Antibody; DACT1 (Capper; Antagonist of beta-Catenin; Homolog 1 (Xenopus laevis); DAPPER; DAPPER1; DPR1; FRODO; HDPR1; THYEX3) (Biotin); Capper; THYEX3; anti-DACT1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 5D8
• Specificity: Recognizes DACT1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-DACT1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: DACT1 (NP_057735.2, 738aa-836aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAKTFVKIKASHNLKKKILRFRSGSLKLMTTV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged DACT1 is 1 ng/ml as a capture antibody.)

Related Product Information for anti-DACT1 antibody

Mouse monoclonal antibody raised against a partial recombinant DACT1.

Product Categories/Family for anti-DACT1 antibody

Antibodies; Catenin

NCBI and Uniprot Product Information

• NCBI GI #: 24158478
• NCBI GeneID: 51339
• NCBI Accession #: NP_057735.2
• NCBI GenBank Nucleotide #: NM_016651.5
• UniProt Accession #: Q9NYF0; Q86TY0; A8MYJ2
• Molecular Weight: 86,212 Da
• NCBI Official Full Name: dapper homolog 1 isoform 1
• NCBI Official Synonym Full Names: dishevelled-binding antagonist of beta-catenin 1
• NCBI Official Symbol: DACT1
• NCBI Official Synonym Symbols: DPR1; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
• NCBI Protein Information: dapper homolog 1; dapper antagonist of catenin 1; heptacellular carcinoma novel gene 3; dapper, antagonist of beta-catenin, homolog 1; hepatocellular carcinoma novel gene 3 protein
• UniProt Protein Name: Dapper homolog 1
• Protein Family: Dapper
• UniProt Gene Name: DACT1
• UniProt Synonym Gene Names: DPR1; HNG3; hDPR1
• UniProt Entry Name: DACT1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the dapper family, characterized by the presence of PDZ-binding motif at the C-terminus. It interacts with, and positively regulates dishevelled-mediated signaling pathways during development. Depletion of this mRNA from xenopus embryos resulted in loss of notochord and head structures, and mice lacking this gene died shortly after birth from severe posterior malformations. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

DACT1: Positively regulates DVL2-mediated signaling pathways during development. Binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway. Interacts with DVL1 and DVL2. Belongs to the dapper family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 14q23.1

Cellular Component: nucleoplasm; cytoplasm; synapse; cell junction; beta-catenin destruction complex; cytosol

Molecular Function: protein binding; protein kinase C binding; protein kinase A binding; beta-catenin binding

Biological Process: negative regulation of JNK cascade; negative regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; dendrite morphogenesis; positive regulation of protein catabolic process; synapse organization and biogenesis; positive regulation of fat cell differentiation; regulation of protein stability; gastrulation with mouth forming second; negative regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; embryonic hindgut morphogenesis