Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PSCD4 polyclonal antibody. Western Blot analysis of PSCD4 expression in human spleen.)

Mouse anti-Human CYTH4 Polyclonal Antibody | anti-CYTH4 antibody

CYTH4 (Cytohesin-4, PH, SEC7 and Coiled-coil Domain-containing Protein 4, CYT4, PSCD4)

Gene Names
CYTH4; CYT4; PSCD4; DJ63G5.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CYTH4; Polyclonal Antibody; CYTH4 (Cytohesin-4; PH; SEC7 and Coiled-coil Domain-containing Protein 4; CYT4; PSCD4); Anti -CYTH4 (Cytohesin-4; anti-CYTH4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CYTH4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
Applicable Applications for anti-CYTH4 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CYTH4, aa1-394 (NP_037517.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PSCD4 polyclonal antibody. Western Blot analysis of PSCD4 expression in human spleen.)

Western Blot (WB) (PSCD4 polyclonal antibody. Western Blot analysis of PSCD4 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of CYTH4 expression in transfected 293T cell line by CYTH4 polyclonal antibody. Lane 1: PSCD4 transfected lysate (43.34kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYTH4 expression in transfected 293T cell line by CYTH4 polyclonal antibody. Lane 1: PSCD4 transfected lysate (43.34kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CYTH4 antibody
Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP.
Product Categories/Family for anti-CYTH4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
45,672 Da
NCBI Official Full Name
CYTH4 protein
NCBI Official Synonym Full Names
cytohesin 4
NCBI Official Symbol
CYTH4
NCBI Official Synonym Symbols
CYT4; PSCD4; DJ63G5.1
NCBI Protein Information
cytohesin-4; pleckstrin homology, Sec7 and coiled-coil domains 4; pleckstrin homology, Sec7 and coiled/coil domains 4; PH, SEC7 and coiled-coil domain-containing protein 4
UniProt Protein Name
Cytohesin-4
Protein Family
UniProt Gene Name
CYTH4
UniProt Synonym Gene Names
CYT4; PSCD4
UniProt Entry Name
CYH4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The encoded protein exhibits GEP activity in vitro with both ARF1 and ARF5 but is inactive with ARF6. The structures of this gene and CYTH1 are very similar. [provided by RefSeq, Aug 2008]

Uniprot Description

cytohesin 4: Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP.

Protein type: GEFs; GEFs, ARF

Chromosomal Location of Human Ortholog: 22q12.3-q13.1

Cellular Component: plasma membrane; trans-Golgi network

Molecular Function: lipid binding; ARF guanyl-nucleotide exchange factor activity

Biological Process: regulation of cell adhesion; vesicle-mediated transport; regulation of ARF protein signal transduction; positive regulation of GTPase activity

Research Articles on CYTH4

Similar Products

Product Notes

The CYTH4 cyth4 (Catalog #AAA6004894) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYTH4 (Cytohesin-4, PH, SEC7 and Coiled-coil Domain-containing Protein 4, CYT4, PSCD4) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYTH4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CYTH4 cyth4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDLCHPEPAE LSSGETEELQ RIKWHRKQLL EDIQKLKDEI ADVFAQIDCF ESAEESRMAQ KEKELCIGRK KFNMDPAKGI QYFIEHKLLT PDVQDIARFL YKGEGLNKTA IGTYLGERDP INLQVLQAFV DCHEFANLNL VQALRQFLWS FRLPGEAQKI DRMMEAFATR YCLCNPGVFQ STDTCYVLSF SIIMLNTSLH NPNVRDRPPF ERFVSMNRGI NNGSDLPEDQ LRNLFDSIKS EPFSIPEDDG NDLTHTFFNP DREGWLLKLG GRVKTWKRRW FILTDNCLYY FEFTTDKEPR GIIPLENLSV QKVDDPKKPF CLELYNPSCR GQKIKACKTD GDGRVVEGKH ESYRISATSA EERDQWIESI RASITRVPFY DLVSTRKKKI ASKQ. It is sometimes possible for the material contained within the vial of "CYTH4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.