Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CYP3A7 Antibody Titration: 2.5ug/mlPositive Control: Human Liver)

Rabbit CYP3A7 Polyclonal Antibody | anti-CYP3A7 antibody

CYP3A7 antibody - middle region

Gene Names
CYP3A7; CP37; CYPIIIA7; P450-HFLA; P-450111A7; P-450(HFL33)
Reactivity
Cow, Dog, Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CYP3A7; Polyclonal Antibody; CYP3A7 antibody - middle region; anti-CYP3A7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI
Sequence Length
503
Applicable Applications for anti-CYP3A7 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 75%; Guinea Pig: 83%; Human: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP3A7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CYP3A7 Antibody Titration: 2.5ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CYP3A7 Antibody Titration: 2.5ug/mlPositive Control: Human Liver)
Related Product Information for anti-CYP3A7 antibody
This is a rabbit polyclonal antibody against CYP3A7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.This gene, CYP3A7, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Transcript variants have been described, but it is not known whether these transcripts are normally produced.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
cytochrome P450 3A7
NCBI Official Synonym Full Names
cytochrome P450 family 3 subfamily A member 7
NCBI Official Symbol
CYP3A7
NCBI Official Synonym Symbols
CP37; CYPIIIA7; P450-HFLA; P-450111A7; P-450(HFL33)
NCBI Protein Information
cytochrome P450 3A7
UniProt Protein Name
Cytochrome P450 3A7
Protein Family
UniProt Gene Name
CYP3A7
UniProt Entry Name
CP3A7_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes, which participate in drug metabolism and the synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. This gene is part of a cluster of related genes on chromosome 7q21.1. Naturally-occurring readthrough transcription occurs between this gene and the downstream CYP3A51P pseudogene and is represented by GeneID:100861540. [provided by RefSeq, Jan 2015]

Uniprot Description

CYP3A7: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; Cofactor and Vitamin Metabolism - retinol; Lipid Metabolism - linoleic acid; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Xenobiotic Metabolism - metabolism by cytochrome P450; Xenobiotic Metabolism - drug metabolism - other enzymes; EC 1.14.14.1

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: endoplasmic reticulum membrane

Molecular Function: iron ion binding; heme binding; oxygen binding; monooxygenase activity

Biological Process: xenobiotic metabolic process

Research Articles on CYP3A7

Similar Products

Product Notes

The CYP3A7 cyp3a7 (Catalog #AAA3206042) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP3A7 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYP3A7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP3A7 cyp3a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSVKQIKEGR LKETQKHRVD FLQLMIDSQN SKDSETHKAL SDLELMAQSI. It is sometimes possible for the material contained within the vial of "CYP3A7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.