Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CYP2E1 rabbit polyclonal antibody. Western Blot analysis of CYP2E1 expression in human colon.)

Rabbit anti-Human CYP2E1 Polyclonal Antibody | anti-CYP2E1 antibody

CYP2E1 (P450IIE1, Cytochrome P450, Family 2, Subfamily E, Polypeptide 1, 4-nitrophenol 2-hydroxylase, CPE1, CYP2E, CYPIIE1, Cytochrome P450 2E1, Cytochrome P450-J, P450C2E, P450-J) (AP)

Gene Names
CYP2E1; CPE1; CYP2E; P450-J; P450C2E
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYP2E1; Polyclonal Antibody; CYP2E1 (P450IIE1; Cytochrome P450; Family 2; Subfamily E; Polypeptide 1; 4-nitrophenol 2-hydroxylase; CPE1; CYP2E; CYPIIE1; Cytochrome P450 2E1; Cytochrome P450-J; P450C2E; P450-J) (AP); anti-CYP2E1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CYP2E1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CYP2E1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CYP2E1, aa1-493 (NP_000764.1).
Immunogen Sequence
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAGTETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGCIPPRYKLCVIPRS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CYP2E1 rabbit polyclonal antibody. Western Blot analysis of CYP2E1 expression in human colon.)

Western Blot (WB) (CYP2E1 rabbit polyclonal antibody. Western Blot analysis of CYP2E1 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of CYP2E1 expression in transfected 293T cell line by CYP2E1 polyclonal antibody. Lane 1: CYP2E1 transfected lysate (56.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYP2E1 expression in transfected 293T cell line by CYP2E1 polyclonal antibody. Lane 1: CYP2E1 transfected lysate (56.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CYP2E1 antibody
P450IIE1, also known as CYP2E1, is a member of the P450IIE subfamily which is ethanol-inducible. It has 1 gene which is mapped to 10q24.3-qter, and a second in rat and in man. Both the rat and human proteins encoded by this gene contain 493aa and calculated molecular masses of 56,634 and 56,916 daltons, respectively. In addition, genetic polymorphisms in the 5-prime flanking region of the human P450IIE1 gene affect its binding of transacting factor and change its transcriptional regulation, which may lead to interindividual differences of microsomal drug oxidation activity. P450IIE1 is an important enzyme for the catalysis of the conversion of ethanol to acetaldehyde and to acetate in humans, and it is also involved in the metabolism of nitrosamines. Due to the possible correlation of P450IIE1 genes with malignancy, clinical studies of RFLP patterns of these genes in cancer may be useful.
Product Categories/Family for anti-CYP2E1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,849 Da
NCBI Official Full Name
cytochrome P450 2E1
NCBI Official Synonym Full Names
cytochrome P450, family 2, subfamily E, polypeptide 1
NCBI Official Symbol
CYP2E1
NCBI Official Synonym Symbols
CPE1; CYP2E; P450-J; P450C2E
NCBI Protein Information
cytochrome P450 2E1; CYPIIE1; cytochrome P450-J; microsomal monooxygenase; xenobiotic monooxygenase; 4-nitrophenol 2-hydroxylase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIE (ethanol-inducible), polypeptide 1
UniProt Protein Name
Cytochrome P450 2E1
Protein Family
UniProt Gene Name
CYP2E1
UniProt Synonym Gene Names
CYP2E
UniProt Entry Name
CP2E1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is induced by ethanol, the diabetic state, and starvation. The enzyme metabolizes both endogenous substrates, such as ethanol, acetone, and acetal, as well as exogenous substrates including benzene, carbon tetrachloride, ethylene glycol, and nitrosamines which are premutagens found in cigarette smoke. Due to its many substrates, this enzyme may be involved in such varied processes as gluconeogenesis, hepatic cirrhosis, diabetes, and cancer. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP2E1: Metabolizes several precarcinogens, drugs, and solvents to reactive metabolites. Inactivates a number of drugs and xenobiotics and also bioactivates many xenobiotic substrates to their hepatotoxic or carcinogenic forms. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; Mitochondrial; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Lipid Metabolism - arachidonic acid; Lipid Metabolism - linoleic acid; Endoplasmic reticulum; EC 1.14.13.n7; Xenobiotic Metabolism - metabolism by cytochrome P450

Chromosomal Location of Human Ortholog: 10q26.3

Cellular Component: intrinsic to endoplasmic reticulum membrane; Golgi membrane; endoplasmic reticulum membrane; mitochondrion; intracellular membrane-bound organelle; cytoplasm

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen; enzyme binding; iron ion binding; heme binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; arachidonic acid epoxygenase activity; steroid hydroxylase activity; oxidoreductase activity; oxygen binding; monooxygenase activity

Biological Process: steroid metabolic process; response to ethanol; triacylglycerol metabolic process; response to ozone; xenobiotic metabolic process; exogenous drug catabolic process; monoterpenoid metabolic process; epoxygenase P450 pathway; heterocycle metabolic process; drug metabolic process; response to organic nitrogen

Research Articles on CYP2E1

Similar Products

Product Notes

The CYP2E1 cyp2e1 (Catalog #AAA6375468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP2E1 (P450IIE1, Cytochrome P450, Family 2, Subfamily E, Polypeptide 1, 4-nitrophenol 2-hydroxylase, CPE1, CYP2E, CYPIIE1, Cytochrome P450 2E1, Cytochrome P450-J, P450C2E, P450-J) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP2E1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP2E1 cyp2e1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP2E1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.