Rabbit anti-Human CYP2A13 Polyclonal Antibody | anti-CYP2A13 antibody

CYP2A13 (Cytochrome P450 2A13, CYPIIA13) (PE)

Cat. Num. AAA6375423

• Gene Names: CYP2A13; CPAD; CYP2A; CYPIIA13
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CYP2A13; Polyclonal Antibody; CYP2A13 (Cytochrome P450 2A13; CYPIIA13) (PE); anti-CYP2A13 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CYP2A13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1546

• Applicable Applications for anti-CYP2A13 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CYP2A13, aa1-494 (AAI53001.1).
• Immunogen Sequence: MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYP2A13 expression in transfected 293T cell line by CYP2A13 polyclonal antibody. Lane 1: CYP2A13 transfected lysate (54.34kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CYP2A13 antibody

CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.

Product Categories/Family for anti-CYP2A13 antibody

Antibodies; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 157169691
• NCBI GeneID: 1553
• NCBI Official Full Name: Synthetic construct Homo sapiens clone IMAGE:100016243, MGC:184250 cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13) mRNA, encodes complete protein
• NCBI Official Synonym Full Names: cytochrome P450 family 2 subfamily A member 13
• NCBI Official Symbol: CYP2A13
• NCBI Official Synonym Symbols: CPAD; CYP2A; CYPIIA13
• NCBI Protein Information: cytochrome P450 2A13
• Protein Family: Cytochrome

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008]