Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: Human lung microsome lysateLane 2-5: 150 ug mouse lung microsome lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1: 10000Gene Name:CYP1B1Submitted by:Jing Peng, Fox Chase Cancer Center)

Rabbit CYP1B1 Polyclonal Antibody | anti-CYP1B1 antibody

CYP1B1 antibody - middle region

Gene Names
CYP1B1; CP1B; ASGD6; GLC3A; CYPIB1; P4501B1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYP1B1; Polyclonal Antibody; CYP1B1 antibody - middle region; anti-CYP1B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSLVDVMPWLQY
Sequence Length
543
Applicable Applications for anti-CYP1B1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP1B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: Human lung microsome lysateLane 2-5: 150 ug mouse lung microsome lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1: 10000Gene Name:CYP1B1Submitted by:Jing Peng, Fox Chase Cancer Center)

Western Blot (WB) (Lanes:Lane 1: Human lung microsome lysateLane 2-5: 150 ug mouse lung microsome lysatePrimary Antibody Dilution:1: 1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1: 10000Gene Name:CYP1B1Submitted by:Jing Peng, Fox Chase Cancer Center)

Western Blot (WB)

(WB Suggested Anti-CYP1B1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CYP1B1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-CYP1B1 antibody
This is a rabbit polyclonal antibody against CYP1B1. It was validated on Western Blot

Target Description: CYP1B1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP1B1 localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-CYP1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
cytochrome P450 1B1
NCBI Official Synonym Full Names
cytochrome P450 family 1 subfamily B member 1
NCBI Official Symbol
CYP1B1
NCBI Official Synonym Symbols
CP1B; ASGD6; GLC3A; CYPIB1; P4501B1
NCBI Protein Information
cytochrome P450 1B1
UniProt Protein Name
Cytochrome P450 1B1
Protein Family
UniProt Gene Name
CYP1B1
UniProt Entry Name
CP1B1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene localizes to the endoplasmic reticulum and metabolizes procarcinogens such as polycyclic aromatic hydrocarbons and 17beta-estradiol. Mutations in this gene have been associated with primary congenital glaucoma; therefore it is thought that the enzyme also metabolizes a signaling molecule involved in eye development, possibly a steroid. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP1B1: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Defects in CYP1B1 are the cause of primary congenital glaucoma type 3A (GLC3A). GLC3A is an autosomal recessive form of primary congenital glaucoma (PCG). PCG is characterized by marked increase of intraocular pressure at birth or early childhood, large ocular globes (buphthalmos) and corneal edema. It results from developmental defects of the trabecular meshwork and anterior chamber angle of the eye that prevent adequate drainage of aqueous humor. Defects in CYP1B1 are a cause of primary open angle glaucoma (POAG). POAG is a complex and genetically heterogeneous ocular disorder characterized by a specific pattern of optic nerve and visual field defects. The angle of the anterior chamber of the eye is open, and usually the intraocular pressure is increased. The disease is asymptomatic until the late stages, by which time significant and irreversible optic nerve damage has already taken place. In some cases, POAG shows digenic inheritance involving mutations in CYP1B1 and MYOC genes. Defects in CYP1B1 are a cause of Peters anomaly (PAN). Peters anomaly is a congenital defect of the anterior chamber of the eye. Belongs to the cytochrome P450 family.

Protein type: Xenobiotic Metabolism - metabolism by cytochrome P450; EC 1.14.14.1; Oxidoreductase; Amino Acid Metabolism - tryptophan

Chromosomal Location of Human Ortholog: 2p22.2

Cellular Component: endoplasmic reticulum membrane; mitochondrion

Molecular Function: iron ion binding; heme binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; oxygen binding; monooxygenase activity

Biological Process: steroid metabolic process; estrogen metabolic process; retinal metabolic process; collagen fibril organization; positive regulation of apoptosis; response to toxin; positive regulation of JAK-STAT cascade; negative regulation of cell proliferation; visual perception; retinol metabolic process; arachidonic acid metabolic process; angiogenesis; cell adhesion; nitric oxide biosynthetic process; negative regulation of cell migration; negative regulation of cell adhesion mediated by integrin; epoxygenase P450 pathway; positive regulation of angiogenesis; inhibition of NF-kappaB transcription factor; toxin metabolic process; xenobiotic metabolic process; blood vessel morphogenesis; endothelial cell migration; aromatic compound metabolic process; membrane lipid catabolic process; induction of apoptosis by oxidative stress; sterol metabolic process

Disease: Peters Anomaly; Glaucoma 3, Primary Congenital, A; Glaucoma 3, Primary Infantile, B

Research Articles on CYP1B1

Similar Products

Product Notes

The CYP1B1 cyp1b1 (Catalog #AAA3210417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP1B1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYP1B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP1B1 cyp1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVANVMSAVC FGCRYSHDDP EFRELLSHNE EFGRTVGAGS LVDVMPWLQY. It is sometimes possible for the material contained within the vial of "CYP1B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.