Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Sample Type :Rat thyrocytes-FRTL-5 Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:100 Color/Signal Descriptions :Green: CYCSBlue: DAPIGene Name :CYCSSubmitted by :Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center )

Rabbit CYCS Polyclonal Antibody | anti-CYCS antibody

CYCS antibody - N-terminal region

Gene Names
CYCS; CYC; HCS; THC4
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
CYCS; Polyclonal Antibody; CYCS antibody - N-terminal region; anti-CYCS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGII
Sequence Length
105
Applicable Applications for anti-CYCS antibody
Immunofluorescence (IF), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunofluorescence (IF)

(Sample Type :Rat thyrocytes-FRTL-5 Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:100 Color/Signal Descriptions :Green: CYCSBlue: DAPIGene Name :CYCSSubmitted by :Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center )

Immunofluorescence (IF) (Sample Type :Rat thyrocytes-FRTL-5 Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:100 Color/Signal Descriptions :Green: CYCSBlue: DAPIGene Name :CYCSSubmitted by :Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center )
Related Product Information for anti-CYCS antibody
This is a rabbit polyclonal antibody against CYCS. It was validated on Western Blot

Target Description: This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.
Product Categories/Family for anti-CYCS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
cytochrome c
NCBI Official Synonym Full Names
cytochrome c, somatic
NCBI Official Symbol
CYCS
NCBI Official Synonym Symbols
CYC; HCS; THC4
NCBI Protein Information
cytochrome c
UniProt Protein Name
Cytochrome c
Protein Family
UniProt Gene Name
CYCS
UniProt Synonym Gene Names
CYC
UniProt Entry Name
CYC_HUMAN

NCBI Description

This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010]

Uniprot Description

CYCS: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Belongs to the cytochrome c family.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Oxidoreductase; Mitochondrial; Apoptosis

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: protein phosphatase type 2A complex; mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; nucleus; cytosol

Molecular Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; protein binding; iron ion binding; heme binding; protein serine/threonine phosphatase activity

Biological Process: mitochondrion organization and biogenesis; cellular metabolic process; response to reactive oxygen species; dephosphorylation; apoptosis; organelle organization and biogenesis; cellular respiration; mitochondrial electron transport, cytochrome c to oxygen; DNA fragmentation during apoptosis; caspase activation via cytochrome c; transmembrane transport; mitochondrial electron transport, ubiquinol to cytochrome c

Disease: Thrombocytopenia 4

Research Articles on CYCS

Similar Products

Product Notes

The CYCS cycs (Catalog #AAA3215036) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYCS antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CYCS can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Researchers should empirically determine the suitability of the CYCS cycs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IFIMKCSQCH TVEKGGKHKT GPNLHGLFGR KTGQAPGYSY TAANKNKGII. It is sometimes possible for the material contained within the vial of "CYCS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.