Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CCND2 expression in transfected 293T cell line by CCND2 polyclonal antibody. Lane 1: CCND2 transfected lysate (33.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Cyclin D2 Polyclonal Antibody | anti-CCND2 antibody

Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758) APC

Gene Names
CCND2; KIAK0002
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cyclin D2; Polyclonal Antibody; Cyclin D2 (CCND2; G1/S-specific Cyclin-D2; KIAK0002; MGC102758) APC; anti-CCND2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCND2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CCND2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCND2, aa1-289 (NP_001750.1).
Immunogen Sequence
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCND2 expression in transfected 293T cell line by CCND2 polyclonal antibody. Lane 1: CCND2 transfected lysate (33.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCND2 expression in transfected 293T cell line by CCND2 polyclonal antibody. Lane 1: CCND2 transfected lysate (33.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CCND2 and CDKN1A. HeLa cells were stained with CCND2 rabbit purified polyclonal 1:1200 and CDKN1A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CCND2 and CDKN1A. HeLa cells were stained with CCND2 rabbit purified polyclonal 1:1200 and CDKN1A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CCND2 antibody
Cyclins are proteins that regulate cell cycle progression by interacting with cdc2 kinase or related kinases. Human cyclins have been grouped into 5 types, A through E, based largely upon sequence similarity. The D-type cyclins (D1, D2, and D3) are a family of cell cycle regulators involved in the G1/S phase transition of the cell cycle. On binding to cyclin-dependent kinases CDK4 or CDK6 and activation by a CDK-activating kinase complex, the cyclin-CDK complex activates numerous genes involved in DNA synthesis and cell cycle progression. Cyclin D2 a G1 cyclin, is a member of the family of D-type cyclins. Indirect immunofluorescence studies showed that the protein is localized to the nucleus in G0, suggesting a nuclear function for cyclin D2 in quiescent cells. It is found to be associated with the cyclin-dependent kinases, CDK2 and CDK4 and thus mediates the phosphorylation of tumor suppressor protein Rb during growth arrest. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation.
Product Categories/Family for anti-CCND2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
894
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,067 Da
NCBI Official Full Name
G1/S-specific cyclin-D2
NCBI Official Synonym Full Names
cyclin D2
NCBI Official Symbol
CCND2
NCBI Official Synonym Symbols
KIAK0002
NCBI Protein Information
G1/S-specific cyclin-D2; G1/S-specific cyclin D2
UniProt Protein Name
G1/S-specific cyclin-D2
Protein Family
UniProt Gene Name
CCND2
UniProt Entry Name
CCND2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. [provided by RefSeq, Oct 2008]

Uniprot Description

CCND2: Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/p27Kip1, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Interacts with either CDK4 or CDK6 protein kinase to form a serine/threonine kinase holoenzyme complex. The cyclin subunit imparts substrate specificity to the complex. Component of the ternary complex cyclin D/CDK4/p27Kip1 required for nuclear translocation and modulation of CDK4-mediated kinase activity. Belongs to the cyclin family. Cyclin D subfamily.

Protein type: Motility/polarity/chemotaxis; Cell cycle regulation

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: nucleoplasm; nuclear membrane; cyclin-dependent protein kinase holoenzyme complex; nucleolus; cytosol; chromatin; nucleus

Molecular Function: protein binding; protein kinase binding

Biological Process: positive regulation of cyclin-dependent protein kinase activity; cell division; positive regulation of protein amino acid phosphorylation; cell cycle

Disease: Megalencephaly-polymicrogyria-polydactyly-hydrocephalus Syndrome 3

Research Articles on CCND2

Similar Products

Product Notes

The CCND2 ccnd2 (Catalog #AAA6375293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cyclin D2 (CCND2, G1/S-specific Cyclin-D2, KIAK0002, MGC102758) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin D2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCND2 ccnd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin D2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.