Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CYB5R1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Rabbit anti-Human, Rat CYB5R1 Polyclonal Antibody | anti-CYB5R1 antibody
CYB5R1 Rabbit pAb
Gene Names
CYB5R1; B5R1; B5R2; B5R.1; NQO3A2; humb5R2
Reactivity
Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
CYB5R1; Polyclonal Antibody; CYB5R1 Rabbit pAb; B5R.1; B5R1; B5R2; NQO3A2; humb5R2; anti-CYB5R1 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Applicable Applications for anti-CYB5R1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IHC: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-305 of human CYB5R1 (NP_057327.2).
Positive Samples
A-431, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CYB5R1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using CYB5R1 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Human esophageal using CYB5R1 Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Human esophageal using CYB5R1 Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat ovary using CYB5R1 Rabbit pAb at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded Rat ovary using CYB5R1 Rabbit pAb at dilution of 1:100 (40x lens).)
Product Categories/Family for anti-CYB5R1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,095 Da
NCBI Official Full Name
NADH-cytochrome b5 reductase 1
NCBI Official Synonym Full Names
cytochrome b5 reductase 1
NCBI Official Symbol
CYB5R1
NCBI Official Synonym Symbols
B5R1; B5R2; B5R.1; NQO3A2; humb5R2
NCBI Protein Information
NADH-cytochrome b5 reductase 1; NAD(P)H:quinone oxidoreductase type 3, polypeptide A2
UniProt Protein Name
NADH-cytochrome b5 reductase 1
Protein Family
UniProt Gene Name
CYB5R1
UniProt Synonym Gene Names
NQO3A2; b5R.1
UniProt Entry Name
NB5R1_HUMAN
Uniprot Description
CYB5R1: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
Protein type: Oxidoreductase; EC 1.6.2.2; Carbohydrate Metabolism - amino sugar and nucleotide sugar; Membrane protein, integral
Chromosomal Location of Human Ortholog: 1q32.1
Cellular Component: membrane; mitochondrion; integral to membrane
Molecular Function: cytochrome-b5 reductase activity
Biological Process: sterol biosynthetic process
Research Articles on CYB5R1
Similar Products
Product Notes
The CYB5R1 cyb5r1 (Catalog #AAA9142641) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYB5R1 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYB5R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the CYB5R1 cyb5r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGIQTSPVLL ASLGVGLVTL LGLAVGSYLV RRSRRPQVTL LDPNEKYLLR LLDKTTVSHN TKRFRFALPT AHHTLGLPVG KHIYLSTRID GSLVIRPYTP VTSDEDQGYV DLVIKVYLKG VHPKFPEGGK MSQYLDSLKV GDVVEFRGPS GLLTYTGKGH FNIQPNKKSP PEPRVAKKLG MIAGGTGITP MLQLIRAILK VPEDPTQCFL LFANQTEKDI ILREDLEELQ ARYPNRFKLW FTLDHPPKDW AYSKGFVTAD MIREHLPAPG DDVLVLLCGP PPMVQLACHP NLDKLGYSQK MRFTY. It is sometimes possible for the material contained within the vial of "CYB5R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
