Western Blot (WB)
(CYB5-M polyclonal antibody. Western Blot analysis of CYB5-M expression in human liver.)
Mouse anti-Human CYB5B Polyclonal Antibody | anti-CYB5B antibody
CYB5B (Cytochrome B5 Type B, Cytochrome B5 Outer Mitochondrial Membrane Isoform, CYB5M, OMB5)
Gene Names
CYB5B; OMB5; CYB5-M; CYPB5M
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
CYB5B; Polyclonal Antibody; CYB5B (Cytochrome B5 Type B; Cytochrome B5 Outer Mitochondrial Membrane Isoform; CYB5M; OMB5); Anti -CYB5B (Cytochrome B5 Type B; anti-CYB5B antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CYB5B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Applicable Applications for anti-CYB5B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CYB5B, aa1-146 (AAH04373.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(CYB5-M polyclonal antibody. Western Blot analysis of CYB5-M expression in human liver.)
Western Blot (WB)
(CYB5-M polyclonal antibody. Western Blot analysis of CYB5-M expression in human liver.)
Western Blot (WB)
(CYB5B polyclonal antibody. Western Blot analysis of CYB5B expression in Jurkat.)
Western Blot (WB)
(CYB5B polyclonal antibody. Western Blot analysis of CYB5B expression in Jurkat.)
Western Blot (WB)
(Western Blot analysis of CYB5B expression in transfected 293T cell line by CYB5B polyclonal antibody. Lane 1: CYB5-M transfected lysate (16.06kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CYB5B expression in transfected 293T cell line by CYB5B polyclonal antibody. Lane 1: CYB5-M transfected lysate (16.06kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CYB5B antibody
Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Product Categories/Family for anti-CYB5B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,332 Da
NCBI Official Full Name
cytochrome b5 type B
NCBI Official Synonym Full Names
cytochrome b5 type B (outer mitochondrial membrane)
NCBI Official Symbol
CYB5B
NCBI Official Synonym Symbols
OMB5; CYB5-M; CYPB5M
NCBI Protein Information
cytochrome b5 type B; type 2 cyt-b5; outer mitochondrial membrane cytochrome b5; cytochrome b5 outer mitochondrial membrane isoform
UniProt Protein Name
Cytochrome b5 type B
Protein Family
UniProt Gene Name
CYB5B
UniProt Synonym Gene Names
CYB5M; OMB5
UniProt Entry Name
CYB5B_HUMAN
Uniprot Description
CYB5B: Cytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. Belongs to the cytochrome b5 family.
Protein type: Mitochondrial; Oxidoreductase; Membrane protein, integral
Chromosomal Location of Human Ortholog: 16q22.1
Cellular Component: mitochondrial outer membrane; membrane; integral to membrane
Molecular Function: metal ion binding; heme binding
Research Articles on CYB5B
Similar Products
Product Notes
The CYB5B cyb5b (Catalog #AAA6004806) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYB5B (Cytochrome B5 Type B, Cytochrome B5 Outer Mitochondrial Membrane Isoform, CYB5M, OMB5) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYB5B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CYB5B cyb5b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATAEASGSD GKGQEVETSV TYYRLEEVAK RNSLKELWLV IHGRVYDVTR FLNEHPGGEE VLLEQAGVDA SESFEDVGHS SDAREMLKQY YIGDIHPSDL KPESGSKDPS KNDTCKSCWA YWILPIIGAV LLGFLYRYYT SESKSS. It is sometimes possible for the material contained within the vial of "CYB5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
