Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CXCR6 expression in transfected 293T cell line by CXCR6 polyclonal antibody. Lane 1: CXCR6 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CXCR6 Polyclonal Antibody | anti-CXCR6 antibody

CXCR6 (C-X-C Chemokine Receptor Type 6, CXC-R6, CXCR-6, CDw186, G-protein Coupled Receptor STRL33, G-protein Coupled Receptor Bonzo, CD186, BONZO, STRL33, TYMSTR) (AP)

Gene Names
CXCR6; BONZO; CD186; STRL33; TYMSTR
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CXCR6; Polyclonal Antibody; CXCR6 (C-X-C Chemokine Receptor Type 6; CXC-R6; CXCR-6; CDw186; G-protein Coupled Receptor STRL33; G-protein Coupled Receptor Bonzo; CD186; BONZO; STRL33; TYMSTR) (AP); anti-CXCR6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CXCR6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1968
Applicable Applications for anti-CXCR6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human CXCR6, aa1-342 (NP_006555.1).
Immunogen Sequence
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CXCR6 expression in transfected 293T cell line by CXCR6 polyclonal antibody. Lane 1: CXCR6 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CXCR6 expression in transfected 293T cell line by CXCR6 polyclonal antibody. Lane 1: CXCR6 transfected lysate (39.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CXCR6 antibody
Coreceptor usage of primary human immunodeficiency virus type 1 (HIV-1) isolates varies according to biological phenotype. The chemokine receptors CCR5 and CXCR4 are the major coreceptors that, together with CD4, govern HIV-1 entry into cells. Some HIV-1, HIV-2, and SIV isolates of different genetic subtypes and biological phenotypes use other chemokine receptors, such as CXCR6, a T-lymphocyte-expressed seven-transmembrane domain receptor that mediates fusion, entry, and trafficking of tumor-infiltrating lymphocytes.
Product Categories/Family for anti-CXCR6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens C-X-C motif chemokine receptor 6 (CXCR6), mRNA
NCBI Official Synonym Full Names
C-X-C motif chemokine receptor 6
NCBI Official Symbol
CXCR6
NCBI Official Synonym Symbols
BONZO; CD186; STRL33; TYMSTR
NCBI Protein Information
C-X-C chemokine receptor type 6
UniProt Protein Name
C-X-C chemokine receptor type 6
Protein Family
UniProt Gene Name
CXCR6
UniProt Synonym Gene Names
BONZO; STRL33; TYMSTR; CXC-R6; CXCR-6
UniProt Entry Name
CXCR6_HUMAN

Uniprot Description

CXCR6: Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; coreceptor activity; C-X-C chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; viral genome replication; inflammatory response; chemotaxis

Research Articles on CXCR6

Similar Products

Product Notes

The CXCR6 cxcr6 (Catalog #AAA6375248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCR6 (C-X-C Chemokine Receptor Type 6, CXC-R6, CXCR-6, CDw186, G-protein Coupled Receptor STRL33, G-protein Coupled Receptor Bonzo, CD186, BONZO, STRL33, TYMSTR) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCR6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CXCR6 cxcr6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXCR6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.