Western Blot (WB)
(WB Suggested Anti-CXCR6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Rabbit anti-Human CXCR6 Polyclonal Antibody | anti-CXCR6 antibody
CXCR6 antibody - N-terminal region
Gene Names
CXCR6; BONZO; CD186; STRL33; TYMSTR
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CXCR6; Polyclonal Antibody; CXCR6 antibody - N-terminal region; anti-CXCR6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL
Sequence Length
342
Applicable Applications for anti-CXCR6 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CXCR6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CXCR6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-CXCR6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-CXCR6 antibody
This is a rabbit polyclonal antibody against CXCR6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CXCR6 is a receptor for the C-X-C chemokine CXCL16. It is used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.The CXCR6/AKT/mTOR pathway plays a central role in the development of prostate cancer. CXCR6 and CXCR3 act coordinately with respective ligands and are involved in the pathophysiology of Juvenile Idiopathic Arthritis-associated inflammatory processes. The CXCL16-CXCR6-system express in human schwannomas of different localization and in malignant peripheral nerve sheath tumors. The protein may play an important role in the retention of T cells within the lung.
Target Description: CXCR6 is a receptor for the C-X-C chemokine CXCL16. It is used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.The CXCR6/AKT/mTOR pathway plays a central role in the development of prostate cancer. CXCR6 and CXCR3 act coordinately with respective ligands and are involved in the pathophysiology of Juvenile Idiopathic Arthritis-associated inflammatory processes. The CXCL16-CXCR6-system express in human schwannomas of different localization and in malignant peripheral nerve sheath tumors. The protein may play an important role in the retention of T cells within the lung.
Product Categories/Family for anti-CXCR6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
C-X-C chemokine receptor type 6
NCBI Official Synonym Full Names
C-X-C motif chemokine receptor 6
NCBI Official Symbol
CXCR6
NCBI Official Synonym Symbols
BONZO; CD186; STRL33; TYMSTR
NCBI Protein Information
C-X-C chemokine receptor type 6
UniProt Protein Name
C-X-C chemokine receptor type 6
Protein Family
UniProt Gene Name
CXCR6
UniProt Synonym Gene Names
BONZO; STRL33; TYMSTR; CXC-R6; CXCR-6
UniProt Entry Name
CXCR6_HUMAN
Uniprot Description
CXCR6: Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1. Belongs to the G-protein coupled receptor 1 family.
Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3p21
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; coreceptor activity; C-X-C chemokine receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway; viral genome replication; inflammatory response; chemotaxis
Research Articles on CXCR6
Similar Products
Product Notes
The CXCR6 cxcr6 (Catalog #AAA3224414) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCR6 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCR6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CXCR6 cxcr6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEHDYHEDYG FSSFNDSSQE EHQDFLQFSK VFLPCMYLVV FVCGLVGNSL. It is sometimes possible for the material contained within the vial of "CXCR6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
