Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CXCL13 expression in transfected 293T cell line by CXCL13 polyclonal antibody. Lane 1: CXCL13 transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CXCL13 Polyclonal Antibody | anti-CXCL13 antibody

CXCL13 (C-X-C Motif Chemokine 13, Angie, B cell-attracting Chemokine 1, BCA-1, B Lymphocyte Chemoattractant, CXC Chemokine BLC, Small-inducible Cytokine B13, BCA1, BLC, SCYB13) APC

Gene Names
CXCL13; BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CXCL13; Polyclonal Antibody; CXCL13 (C-X-C Motif Chemokine 13; Angie; B cell-attracting Chemokine 1; BCA-1; B Lymphocyte Chemoattractant; CXC Chemokine BLC; Small-inducible Cytokine B13; BCA1; BLC; SCYB13) APC; anti-CXCL13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CXCL13.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1219
Applicable Applications for anti-CXCL13 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human CXCL13, aa1-189 (NP_006410.1).
Immunogen Sequence
MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CXCL13 expression in transfected 293T cell line by CXCL13 polyclonal antibody. Lane 1: CXCL13 transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CXCL13 expression in transfected 293T cell line by CXCL13 polyclonal antibody. Lane 1: CXCL13 transfected lysate (12.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CXCL13 antibody
Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
Product Categories/Family for anti-CXCL13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens C-X-C motif chemokine ligand 13 (CXCL13), transcript variant 1, mRNA
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 13
NCBI Official Symbol
CXCL13
NCBI Official Synonym Symbols
BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13
NCBI Protein Information
C-X-C motif chemokine 13
Protein Family

NCBI Description

B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]

Research Articles on CXCL13

Similar Products

Product Notes

The CXCL13 (Catalog #AAA6375194) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCL13 (C-X-C Motif Chemokine 13, Angie, B cell-attracting Chemokine 1, BCA-1, B Lymphocyte Chemoattractant, CXC Chemokine BLC, Small-inducible Cytokine B13, BCA1, BLC, SCYB13) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CXCL13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXCL13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.