Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CXCL1 expression in transfected 293T cell line by CXCL1 polyclonal antibody. Lane 1: CXCL1 transfected lysate (11.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CXCL1 Polyclonal Antibody | anti-CXCL1 antibody

CXCL1 (Growth-regulated alpha Protein, C-X-C Motif Chemokine 1, GRO-alpha(1-73), Melanoma Growth Stimulatory Activity, MGSA, Neutrophil-activating Protein 3, NAP-3, GRO, GRO1, GROA, SCYB1) (AP)

Gene Names
CXCL1; FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CXCL1; Polyclonal Antibody; CXCL1 (Growth-regulated alpha Protein; C-X-C Motif Chemokine 1; GRO-alpha(1-73); Melanoma Growth Stimulatory Activity; MGSA; Neutrophil-activating Protein 3; NAP-3; GRO; GRO1; GROA; SCYB1) (AP); anti-CXCL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CXCL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CXCL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CXCL1, aa1-107 (NP_001502.1).
Immunogen Sequence
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CXCL1 expression in transfected 293T cell line by CXCL1 polyclonal antibody. Lane 1: CXCL1 transfected lysate (11.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CXCL1 expression in transfected 293T cell line by CXCL1 polyclonal antibody. Lane 1: CXCL1 transfected lysate (11.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CXCL1 antibody
GRO Alpha (CXCL1), a small cytokine belonging to the CXC chemokine family, secreted by human melanoma cells, has mitogenic properties and is implicated in melanoma pathogenesis. GRO alpha is expressed by macrophages, neutrophils and epithelial cells, and has neutrophil chemoattractant activity. GRO Alpha plays a role in spinal cord development by inhibiting the migration of oligodendrocyte precursors and is involved in the processes of angiogenesis, inflammation, wound healing, and tumorigenesis. This chemokine elicits its effects by signaling through the chemokine receptor CXCR2. An initial study in mice showed evidence that GRO alpha decreased the severity of multiple sclerosis and may offer a neuro-protective function.
Product Categories/Family for anti-CXCL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,301 Da
NCBI Official Full Name
growth-regulated alpha protein
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
NCBI Official Symbol
CXCL1
NCBI Official Synonym Symbols
FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a
NCBI Protein Information
growth-regulated alpha protein; MGSA alpha; GRO-alpha(1-73); C-X-C motif chemokine 1; fibroblast secretory protein; neutrophil-activating protein 3; melanoma growth stimulatory activity alpha; GRO1 oncogene (melanoma growth-stimulating activity); GRO1 onc
UniProt Protein Name
Growth-regulated alpha protein
UniProt Gene Name
CXCL1
UniProt Synonym Gene Names
GRO; GRO1; GROA; MGSA; SCYB1; MGSA; NAP-3
UniProt Entry Name
GROA_HUMAN

NCBI Description

This gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signal through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Jan 2012]

Uniprot Description

CXCL1: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO- alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; chemokine activity; CXCR chemokine receptor binding; enzyme activator activity; receptor binding

Biological Process: positive regulation of catalytic activity; negative regulation of cell proliferation; cell proliferation; nervous system development; G-protein coupled receptor protein signaling pathway; immune response; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; inflammatory response; actin cytoskeleton organization and biogenesis; chemotaxis; signal transduction

Research Articles on CXCL1

Similar Products

Product Notes

The CXCL1 cxcl1 (Catalog #AAA6375160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCL1 (Growth-regulated alpha Protein, C-X-C Motif Chemokine 1, GRO-alpha(1-73), Melanoma Growth Stimulatory Activity, MGSA, Neutrophil-activating Protein 3, NAP-3, GRO, GRO1, GROA, SCYB1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CXCL1 cxcl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.