Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CX3CL1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 3.0ug/ml)

Rabbit CX3CL1 Polyclonal Antibody | anti-CX3CL1 antibody

CX3CL1 Antibody - middle region

Gene Names
CX3CL1; NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
Reactivity
Dog, Human, Pig
Applications
Western Blot
Synonyms
CX3CL1; Polyclonal Antibody; CX3CL1 Antibody - middle region; anti-CX3CL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Pig
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ
Sequence Length
397
Applicable Applications for anti-CX3CL1 antibody
Western Blot (WB)
Homology
Dog: 85%; Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CX3CL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CX3CL1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 3.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CX3CL1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 3.0ug/ml)
Related Product Information for anti-CX3CL1 antibody
This is a rabbit polyclonal antibody against CX3CL1. It was validated on Western Blot
Product Categories/Family for anti-CX3CL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
fractalkine isoform 2
NCBI Official Synonym Full Names
C-X3-C motif chemokine ligand 1
NCBI Official Symbol
CX3CL1
NCBI Official Synonym Symbols
NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin
NCBI Protein Information
fractalkine
UniProt Protein Name
Fractalkine
Protein Family
UniProt Gene Name
CX3CL1
UniProt Synonym Gene Names
FKN; NTT; SCYD1
UniProt Entry Name
X3CL1_HUMAN

NCBI Description

This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, resulting in a Cys-X-X-X-Cys configuration. The encoded protein contains an extended mucin-like stalk with a chemokine domain on top, and exists in both a membrane-anchored form where it acts as a binding molecule, or, in soluble form, as a chemotactic cytokine. The mature form of this protein can be cleaved at the cell surface, yielding different soluble forms that can interact with the G-protein coupled receptor, C-X3-C motif chemokine receptor 1 gene product. This gene plays a role in a wide range of diseases, including cancer, vasculitis, neuropathies, atherosclerosis, inflammatory diseases, and in human immunodeficiency virus infections. [provided by RefSeq, Sep 2017]

Uniprot Description

CX3CL1: The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. Belongs to the intercrine delta family.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: extracellular space; cell surface; integral to membrane; extracellular region; plasma membrane

Molecular Function: protein binding; chemokine activity; receptor binding

Biological Process: neutrophil chemotaxis; positive regulation of transforming growth factor-beta1 production; leukocyte chemotaxis; cytokine and chemokine mediated signaling pathway; defense response; chemotaxis; angiogenesis involved in wound healing; leukocyte adhesive activation; macrophage chemotaxis; positive regulation of angiogenesis; positive regulation of calcium-independent cell-cell adhesion; immune response; cell adhesion; lymphocyte chemotaxis; positive regulation of inflammatory response

Research Articles on CX3CL1

Similar Products

Product Notes

The CX3CL1 cx3cl1 (Catalog #AAA3200293) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CX3CL1 Antibody - middle region reacts with Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CX3CL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CX3CL1 cx3cl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APHQPGPSLW AEAKTSEAPS TQDPSTQAST ASSPAPEENA PSEGQRVWGQ. It is sometimes possible for the material contained within the vial of "CX3CL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.