Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Testis tissue at an antibody concentration of 10ug/ml using anti-CUL3 antibody MBS3215152)

Rabbit CUL3 Polyclonal Antibody | anti-CUL3 antibody

CUL3 antibody - C-terminal region

Gene Names
CUL3; CUL-3; PHA2E
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CUL3; Polyclonal Antibody; CUL3 antibody - C-terminal region; anti-CUL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: QETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTS
Sequence Length
768
Applicable Applications for anti-CUL3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CUL3
Replacement Item
This antibody may replace item sc-11385 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Testis tissue at an antibody concentration of 10ug/ml using anti-CUL3 antibody MBS3215152)

Immunohistochemistry (IHC) (Immunohistochemistry with Testis tissue at an antibody concentration of 10ug/ml using anti-CUL3 antibody MBS3215152)

Western Blot (WB)

(WB Suggested Anti-CUL3 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)

Western Blot (WB) (WB Suggested Anti-CUL3 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)
Related Product Information for anti-CUL3 antibody
This is a rabbit polyclonal antibody against CUL3. It was validated on Western Blot

Target Description: CUL3 is a component of a ubiquitin E3 ligase that is essential for mitotic division.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
Cullin-3
NCBI Official Synonym Full Names
cullin 3
NCBI Official Symbol
CUL3
NCBI Official Synonym Symbols
CUL-3; PHA2E
NCBI Protein Information
cullin-3
UniProt Protein Name
Cullin-3
Protein Family
UniProt Gene Name
CUL3
UniProt Synonym Gene Names
KIAA0617; CUL-3
UniProt Entry Name
CUL3_HUMAN

NCBI Description

This gene encodes a member of the cullin protein family. The encoded protein plays a critical role in the polyubiquitination and subsequent degradation of specific protein substrates as the core component and scaffold protein of an E3 ubiquitin ligase complex. Complexes including the encoded protein may also play a role in late endosome maturation. Mutations in this gene are a cause of type 2E pseudohypoaldosteronism. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]

Uniprot Description

CUL3: a core component of multiple cullin-RING-based BCR (BTB- CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with CAND1. The functional specificity of the BCR complex depends on the BTB domain-containing protein as the susbstrate recognition component. SPOP is involved in ubiquitination of BMI1, H2AFY and DAXX, and probably GLI2 or GLI3. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31A or -B. BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; possibly by mediating ubiquitination of SLC12A3/NCC. Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition. Forms neddylation-dependent homodimers. Component of multiple BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes formed of CUL3, RBX1 and a variable BTB domain-containing protein acting as both, adapter to cullin and substrate recognition subunit. The BCR complex may be active as a heterodimeric complex, in which NEDD8, covalently attached to one CUL3 molecule, binds to the C-terminus of a second CUL3 molecule. Interacts with RBX1, RNF7, CYCE and CAND1. Part of the BCR(SPOP) containing SPOP. Part of the probable BCR(KLHL9-KLHL13) complex with BTB domain proteins KLHL9 and KLHL13. Part of the BCR(KBTBD10) complex containing KBTBD10. Component of the BCR(KLHL12) E3 ubiquitin ligase complex, at least composed of CUL3 and KLHL12 and RBX1. Component of the BCR(KLHL3) E3 ubiquitin ligase complex, at least composed of CUL3 and KLHL3 and RBX1 (Probable). Part of the BCR(ENC1) complex containing ENC1. Part of a complex consisting of BMI1, CUL3 and SPOP. Part of a complex consisting of H2AFY, CUL3 and SPOP. Interacts with KCTD5, KLHL9, KLHL13, GAN, ZBTB16, KLHL21, KLHL3, KLHL15, KLHL20, C16orf44, GMCL1P1, BTBD1. Part of a complex that contains CUL3, RBX1 and GAN. Interacts (via BTB domain) with KLHL17; the interaction regulates surface GRIK2 expression. Widely expressed. Belongs to the cullin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 2q36.2

Cellular Component: Golgi membrane; nucleoplasm; membrane; polar microtubule; cytosol

Molecular Function: protein binding; cyclin binding; protein homodimerization activity; protein heterodimerization activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; POZ domain binding

Biological Process: protein monoubiquitination; positive regulation of cytokinesis; integrin-mediated signaling pathway; proteasomal ubiquitin-dependent protein catabolic process; ER to Golgi vesicle-mediated transport; cell migration; Wnt receptor signaling pathway; protein polyubiquitination; stem cell division; protein ubiquitination; gastrulation; mitotic metaphase plate congression; embryonic cleavage; cyclin catabolic process; COPII coating of Golgi vesicle; negative regulation of Rho protein signal transduction; positive regulation of cell proliferation; stress fiber formation; positive regulation of mitotic metaphase/anaphase transition; trophectodermal cellular morphogenesis; cell cycle arrest; G1/S transition of mitotic cell cycle

Disease: Pseudohypoaldosteronism, Type Iie

Research Articles on CUL3

Similar Products

Product Notes

The CUL3 cul3 (Catalog #AAA3215152) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CUL3 antibody - C-terminal region reacts with Tested: Human; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CUL3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CUL3 cul3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QETDIPEREL VRALQSLACG KPTQRVLTKE PKSKEIENGH IFTVNDQFTS. It is sometimes possible for the material contained within the vial of "CUL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.