Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse CUGBP1 Polyclonal Antibody | anti-CUGBP1 antibody

CUGBP1 (CELF1, BRUNOL2, CUGBP, CUGBP1, NAB50, CUGBP Elav-like Family Member 1, 50kD Nuclear Polyadenylated RNA-binding Protein, Bruno-like Protein 2, CUG Triplet Repeat RNA-binding Protein 1, CUG-BP-and ETR-3-like Factor 1, Deadenylation Factor CUG-BP, Em

Gene Names
CELF1; CUGBP; NAB50; NAPOR; CUG-BP; CUGBP1; hNab50; BRUNOL2; EDEN-BP
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CUGBP1; Polyclonal Antibody; CUGBP1 (CELF1; BRUNOL2; CUGBP; NAB50; CUGBP Elav-like Family Member 1; 50kD Nuclear Polyadenylated RNA-binding Protein; Bruno-like Protein 2; CUG Triplet Repeat RNA-binding Protein 1; CUG-BP-and ETR-3-like Factor 1; Deadenylation Factor CUG-BP; Em; anti-CUGBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CUGBP1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
483
Applicable Applications for anti-CUGBP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human CUGBP1, aa1-393 (NP_941989.1).
Immunogen Sequence
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQTMEGCSSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGSSPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CUGBP1 antibody
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-CUGBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
CUGBP Elav-like family member 1 isoform 2
NCBI Official Synonym Full Names
CUGBP Elav-like family member 1
NCBI Official Symbol
CELF1
NCBI Official Synonym Symbols
CUGBP; NAB50; NAPOR; CUG-BP; CUGBP1; hNab50; BRUNOL2; EDEN-BP
NCBI Protein Information
CUGBP Elav-like family member 1
UniProt Protein Name
CUGBP Elav-like family member 1
UniProt Gene Name
CELF1
UniProt Synonym Gene Names
BRUNOL2; CUGBP; CUGBP1; NAB50; CELF-1; CUG-BP1
UniProt Entry Name
CELF1_HUMAN

NCBI Description

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CELF1: RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre- mRNAs. Activates SM exon 5 inclusion by antagonizing the repressive effect of PTB. Promotes exclusion of exon 11 of the INSR pre-mRNA. Inhibits, together with HNRNPH1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Increases translation and controls the choice of translation initiation codon of CEBPB mRNA. Increases mRNA translation of CEBPB in aging liver. Increases translation of CDKN1A mRNA by antagonizing the repressive effect of CALR3. Mediates rapid cytoplasmic mRNA deadenylation. Recruits the deadenylase PARN to the poly(A) tail of EDEN-containing mRNAs to promote their deadenylation. Required for completion of spermatogenesis. Binds to (CUG)n triplet repeats in the 3'-UTR of transcripts such as DMPK and to Bruno response elements (BREs). Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA. Binds to AU-rich sequences (AREs or EDEN-like) localized in the 3'-UTR of JUN and FOS mRNAs. Binds to the IR RNA. Binds to the 5'-region of CDKN1A and CEBPB mRNAs. Binds with the 5'-region of CEBPB mRNA in aging liver. Belongs to the CELF/BRUNOL family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 11p11

Cellular Component: nucleoplasm; membrane; cytoplasm; nucleus; ribonucleoprotein complex

Molecular Function: mRNA binding; protein binding; translation initiation factor binding; RNA binding; translation repressor activity, nucleic acid binding; BRE binding; nucleotide binding

Biological Process: mRNA splice site selection; embryonic development; regulation of RNA splicing; negative regulation of translation; positive regulation of multicellular organism growth; mRNA processing; spermatid development; germ cell development; RNA interference

Research Articles on CUGBP1

Similar Products

Product Notes

The CUGBP1 celf1 (Catalog #AAA6375114) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CUGBP1 (CELF1, BRUNOL2, CUGBP, CUGBP1, NAB50, CUGBP Elav-like Family Member 1, 50kD Nuclear Polyadenylated RNA-binding Protein, Bruno-like Protein 2, CUG Triplet Repeat RNA-binding Protein 1, CUG-BP-and ETR-3-like Factor 1, Deadenylation Factor CUG-BP, Em reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CUGBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CUGBP1 celf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CUGBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.