Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CTSL2 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit CTSL2 Polyclonal Antibody | anti-CTSV antibody

CTSL2 antibody - N-terminal region

Gene Names
CTSV; CTSU; CATL2; CTSL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTSL2; Polyclonal Antibody; CTSL2 antibody - N-terminal region; anti-CTSV antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVS
Sequence Length
334
Applicable Applications for anti-CTSV antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CTSL2 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CTSL2 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-CTSV antibody
This is a rabbit polyclonal antibody against CTSL2. It was validated on Western Blot

Target Description: The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may play an important role in corneal physiology. This gene is expressed in colorectal and breast carcinomas but not in normal colon, mammary gland, or peritumoral tissues, suggesting a possible role for this gene in tumor processes. Alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-CTSV antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
cathepsin L2 preproprotein
NCBI Official Synonym Full Names
cathepsin V
NCBI Official Symbol
CTSV
NCBI Official Synonym Symbols
CTSU; CATL2; CTSL2
NCBI Protein Information
cathepsin L2
UniProt Protein Name
Cathepsin L2
UniProt Gene Name
CTSL2
UniProt Synonym Gene Names
CATL2; CTSU; CTSV
UniProt Entry Name
CATL2_HUMAN

NCBI Description

The protein encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that may play an important role in corneal physiology. This gene is expressed in colorectal and breast carcinomas but not in normal colon, mammary gland, or peritumoral tissues, suggesting a possible role for this gene in tumor processes. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jan 2011]

Uniprot Description

CTSL2: Cysteine protease. May have an important role in corneal physiology. Belongs to the peptidase C1 family.

Protein type: Protease; Secreted; Secreted, signal peptide; EC 3.4.22.15

Chromosomal Location of Human Ortholog: 9q22.2

Cellular Component: extracellular space; lysosomal lumen; neuron projection; microvillus; apical part of cell; extracellular region; nucleolus; perikaryon; secretory granule; external side of plasma membrane

Molecular Function: protein binding; histone binding; cysteine-type endopeptidase activity; protein complex binding; aminopeptidase activity; kininogen binding; cysteine-type carboxypeptidase activity; peptide binding; cysteine-type peptidase activity

Biological Process: extracellular matrix organization and biogenesis; hair follicle morphogenesis; response to glucocorticoid stimulus; Sertoli cell differentiation; multicellular organismal aging; antigen processing and presentation of exogenous peptide antigen via MHC class II; decidualization; proteolysis; cellular response to starvation; extracellular matrix disassembly; protein autoprocessing; response to glucose stimulus; autophagic cell death; nerve development; spermatogenesis

Research Articles on CTSV

Similar Products

Product Notes

The CTSV ctsl2 (Catalog #AAA3215164) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTSL2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CTSL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTSV ctsl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLDLPKSVDW RKKGYVTPVK NQKQCGSCWA FSATGALEGQ MFRKTGKLVS. It is sometimes possible for the material contained within the vial of "CTSL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.