<
Western Blot (WB)
(Host: RabbitTarget Name: CTRLSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Rabbit CTRL Polyclonal Antibody | anti-CTRL antibody
CTRL antibody - N-terminal region
Gene Names
CTRL; CTRL1
Reactivity
Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTRL; Polyclonal Antibody; CTRL antibody - N-terminal region; anti-CTRL antibody
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL
Sequence Length
264
Applicable Applications for anti-CTRL antibody
Western Blot (WB)
Homology
Dog: 100%; Human: 100%; Mouse: 85%; Pig: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CTRL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CTRLSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CTRLSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CTRLSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CTRLSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CTRLSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CTRLSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-CTRL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-CTRL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-CTRL antibody
This is a rabbit polyclonal antibody against CTRL. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).
Target Description: CTRL contains 1 F-box domain. It is substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.The protein directly interacts with SKP1A and CUL1. A chromosomal aberration involving FBXO25 is a cause of X-linked mental retardation (XLMR).
Product Categories/Family for anti-CTRL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
chymotrypsin-like protease CTRL-1
NCBI Official Synonym Full Names
chymotrypsin like
NCBI Official Symbol
CTRL
NCBI Official Synonym Symbols
CTRL1
NCBI Protein Information
chymotrypsin-like protease CTRL-1
UniProt Protein Name
Chymotrypsin-like protease CTRL-1
Protein Family
UniProt Gene Name
CTRL
UniProt Synonym Gene Names
CTRL1
UniProt Entry Name
CTRL_HUMAN
NCBI Description
This gene encodes a serine-type endopeptidase with chymotrypsin- and elastase-2-like activities. The gene encoding this zymogen is expressed specifically in the pancreas and likely functions as a digestive enzyme. [provided by RefSeq, Sep 2016]
Uniprot Description
CTRL: Belongs to the peptidase S1 family.
Protein type: EC 3.4.21.-; Protease
Chromosomal Location of Human Ortholog: 16q22.1
Cellular Component: extracellular space
Molecular Function: serine-type endopeptidase activity
Biological Process: digestion; proteolysis
Research Articles on CTRL
Similar Products
Product Notes
The CTRL ctrl (Catalog #AAA3201759) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTRL antibody - N-terminal region reacts with Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CTRL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTRL ctrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLLSLTLSLV LLGSSWGCGI PAIKPALSFS QRIVNGENAV LGSWPWQVSL. It is sometimes possible for the material contained within the vial of "CTRL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
