Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CtBP1Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CtBP1 Polyclonal Antibody | anti-CTBP1 antibody

CtBP1 Antibody - C-terminal region

Gene Names
CTBP1; BARS; HADDTS
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CtBP1; Polyclonal Antibody; CtBP1 Antibody - C-terminal region; anti-CTBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHA
Sequence Length
429
Applicable Applications for anti-CTBP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CtBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CtBP1Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CtBP1Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CTBP1 antibody
This is a rabbit polyclonal antibody against CtBP1. It was validated on Western Blot

Target Description: This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein complex which participates in regulation of gene expression during development. Alternative splicing of transcripts from this gene results in multiple transcript variants.
Product Categories/Family for anti-CTBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
C-terminal-binding protein 1 isoform 2
NCBI Official Synonym Full Names
C-terminal binding protein 1
NCBI Official Symbol
CTBP1
NCBI Official Synonym Symbols
BARS; HADDTS
NCBI Protein Information
C-terminal-binding protein 1
UniProt Protein Name
C-terminal-binding protein 1
UniProt Gene Name
CTBP1
UniProt Synonym Gene Names
CTBP; CtBP1
UniProt Entry Name
CTBP1_HUMAN

NCBI Description

This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein complex which participates in regulation of gene expression during development. Alternative splicing of transcripts from this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

CTBP1: Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex. Functions in brown adipose tissue (BAT) differentiation. Corepressor targeting diverse transcription regulators such as GLIS2. Has dehydrogenase activity. Homo- or heterodimer. Heterodimer with CTBP2. Interacts with PRDM16; the interaction represses white adipose tissue (WAT)- specific genes expression. Interacts with GLIS2, FOXP2, HDAC4, HDAC5, HDAC9 and ZNF217. Interacts with adenovirus E1A protein (via its C-terminus); the interaction disrupts the interaction of CTBP1 with RBBP8. Interacts with Epstein-Barr virus EBNA3 and EBNA6. Interacts with ELK3 (via its PXDLS motif). Interacts with RBBP8 (via its PXDLS motif); the interaction is disrupted by binding to adenovirus E1A. Interacts with FOXP1, HIPK2, PNN, NRIP1, MECOM, ZNF366, ZFHX1B and WIZ. Interaction with SATB1 (non-acetylated form); the interaction stabilizes its attachment to DNA and promotes transcription repression. Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.1.1.-; Oxidoreductase; Cell cycle regulation; Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 4p16

Cellular Component: nucleoplasm; transcription factor complex; transcriptional repressor complex; cytosol; nucleus

Molecular Function: protein C-terminus binding; protein domain specific binding; protein binding; protein homodimerization activity; transcription factor activity; NAD binding; transcription factor binding; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

Biological Process: negative regulation of cell proliferation; positive regulation of histone deacetylation; transcription, DNA-dependent; regulation of cell cycle; white fat cell differentiation; negative regulation of transcription from RNA polymerase II promoter; viral genome replication; negative regulation of transcription, DNA-dependent; Golgi organization and biogenesis; protein amino acid phosphorylation; negative regulation of histone acetylation

Disease: Wolf-hirschhorn Syndrome

Research Articles on CTBP1

Similar Products

Product Notes

The CTBP1 ctbp1 (Catalog #AAA3219697) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CtBP1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CtBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTBP1 ctbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVAPTGIPAA VEGIVPSAMS LSHGLPPVAH PPHAPSPGQT VKPEADRDHA. It is sometimes possible for the material contained within the vial of "CtBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.