Western Blot (WB)
(WB Suggested Anti-CSRP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Rabbit CSRP1 Polyclonal Antibody | anti-CSRP1 antibody
CSRP1 antibody - middle region
Gene Names
CSRP1; CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CSRP1; Polyclonal Antibody; CSRP1 antibody - middle region; anti-CSRP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP
Sequence Length
193
Applicable Applications for anti-CSRP1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CSRP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CSRP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Western Blot (WB)
(WB Suggested Anti-CSRP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Related Product Information for anti-CSRP1 antibody
This is a rabbit polyclonal antibody against CSRP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CSRP1 is a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation.CSRP1 is a member of the CSRP family of genes encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in CRP1 is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation Other genes in the family include CSRP2 and CSRP3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: CSRP1 is a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation.CSRP1 is a member of the CSRP family of genes encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in CRP1 is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation Other genes in the family include CSRP2 and CSRP3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-CSRP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
cysteine and glycine-rich protein 1 isoform 1
NCBI Official Synonym Full Names
cysteine and glycine rich protein 1
NCBI Official Symbol
CSRP1
NCBI Official Synonym Symbols
CRP; CRP1; CSRP; CYRP; D1S181E; HEL-141; HEL-S-286
NCBI Protein Information
cysteine and glycine-rich protein 1
UniProt Protein Name
Cysteine and glycine-rich protein 1
Protein Family
UniProt Gene Name
CSRP1
UniProt Synonym Gene Names
CSRP; CYRP; CRP; CRP1
UniProt Entry Name
CSRP1_HUMAN
NCBI Description
This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2010]
Uniprot Description
CSRP1: a LIM protein. Involved in the noncanonical Wnt pathway, which coordinates cell behaviors during dynamic morphogenetic movements of tissues and organs. Interacts with Dishevelled 2 (Dvl2) and Diversin (Div) in zebrafish. Displays coordinate serum induction with c-myc.
Protein type: Motility/polarity/chemotaxis; Cytoskeletal
Chromosomal Location of Human Ortholog: 1q32
Cellular Component: focal adhesion; nucleus
Molecular Function: zinc ion binding
Research Articles on CSRP1
Similar Products
Product Notes
The CSRP1 csrp1 (Catalog #AAA3202033) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSRP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CSRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSRP1 csrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGYGQGAGTL STDKGESLGI KHEEAPGHRP TTNPNASKFA QKIGGSERCP. It is sometimes possible for the material contained within the vial of "CSRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
