Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CSNK1D Polyclonal Antibody)

Rabbit anti-Rat CSNK1D Polyclonal Antibody | anti-CSNK1D antibody

CSNK1D Polyclonal Antibody

Gene Names
CSNK1D; ASPS; CKId; HCKID; FASPS2; CKIdelta; CKI-delta
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CSNK1D; Polyclonal Antibody; CSNK1D Polyclonal Antibody; ASPS; CKIdelta; FASPS2; HCKID; casein kinase 1 delta; anti-CSNK1D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.87 mg/ml (varies by lot)
Sequence Length
415
Applicable Applications for anti-CSNK1D antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK1D (NP_620693.1).
Immunogen Sequence
TYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRAADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTS
Positive Samples
Rat Heart, Rat Brain
Cellular Location
Cell Membrane, Cytoplasm, Golgi Apparatus, Nucleus, Centrosome, Cytoskeleton, Microtubule Organizing Center, Perinuclear Region, Spindle
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CSNK1D Polyclonal Antibody)

Western Blot (WB) (Western blot-CSNK1D Polyclonal Antibody)
Related Product Information for anti-CSNK1D antibody
This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein may also be involved in the regulation of apoptosis, circadian rhythm, microtubule dynamics, chromosome segregation, and p53-mediated effects on growth. The encoded protein is highly similar to the mouse and rat CK1 delta homologs. Three transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 46kDa; 47kDa
Observed: 47kDa
NCBI Official Full Name
casein kinase I isoform delta isoform 1
NCBI Official Synonym Full Names
casein kinase 1 delta
NCBI Official Symbol
CSNK1D
NCBI Official Synonym Symbols
ASPS; CKId; HCKID; FASPS2; CKIdelta; CKI-delta
NCBI Protein Information
casein kinase I isoform delta; casein kinase I
UniProt Protein Name
Casein kinase I isoform delta
Protein Family
UniProt Gene Name
CSNK1D
UniProt Synonym Gene Names
HCKID; CKI-delta; CKId
UniProt Entry Name
KC1D_HUMAN

NCBI Description

This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein may also be involved in the regulation of apoptosis, circadian rhythm, microtubule dynamics, chromosome segregation, and p53-mediated effects on growth. The encoded protein is highly similar to the mouse and rat CK1 delta homologs. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]

Uniprot Description

CK1D: an ubiquitous protein kinase of the CK1 family. Enriched at the centrosomes in interphase and at the spindle during mitosis. May play a role in cell cycle progression. Two splice variant isoforms have been described.

Protein type: EC 2.7.11.26; Protein kinase, CK1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; CK1 group; CK1 family

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: Golgi apparatus; centrosome; spindle microtubule; perinuclear region of cytoplasm; plasma membrane; spindle; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; tau-protein kinase activity; phosphoprotein binding; glycoprotein binding; peptide binding; ATP binding; protein kinase activity

Biological Process: Wnt receptor signaling pathway; organelle organization and biogenesis; endocytosis; spindle assembly; signal transduction; regulation of circadian rhythm; DNA repair; protein amino acid phosphorylation; regulation of cell shape; peptidyl-serine phosphorylation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein amino acid phosphorylation; mitotic cell cycle; circadian regulation of gene expression; G2/M transition of mitotic cell cycle

Disease: Advanced Sleep Phase Syndrome, Familial, 2

Research Articles on CSNK1D

Similar Products

Product Notes

The CSNK1D csnk1d (Catalog #AAA9140407) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSNK1D Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CSNK1D csnk1d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSNK1D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.