Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CSNK1A1L expression in transfected 293T cell line by CSNK1A1L polyclonal antibody. Lane 1: CSNK1A1L transfected lysate (39.1kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CSNK1A1L Polyclonal Antibody | anti-CSNK1A1L antibody

CSNK1A1L (Casein Kinase I Isoform alpha-like, CKI-alpha-like, CK1, MGC33182, RP11-532O21.2)

Gene Names
CSNK1A1L; CK1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CSNK1A1L; Polyclonal Antibody; CSNK1A1L (Casein Kinase I Isoform alpha-like; CKI-alpha-like; CK1; MGC33182; RP11-532O21.2); Anti -CSNK1A1L (Casein Kinase I Isoform alpha-like; anti-CSNK1A1L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CSNK1A1L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
Applicable Applications for anti-CSNK1A1L antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CSNK1A1L, aa1-337 (NP_660204.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CSNK1A1L expression in transfected 293T cell line by CSNK1A1L polyclonal antibody. Lane 1: CSNK1A1L transfected lysate (39.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CSNK1A1L expression in transfected 293T cell line by CSNK1A1L polyclonal antibody. Lane 1: CSNK1A1L transfected lysate (39.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CSNK1A1L antibody
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling.
Product Categories/Family for anti-CSNK1A1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,086 Da
NCBI Official Full Name
casein kinase I isoform alpha-like
NCBI Official Synonym Full Names
casein kinase 1, alpha 1-like
NCBI Official Symbol
CSNK1A1L
NCBI Official Synonym Symbols
CK1
NCBI Protein Information
casein kinase I isoform alpha-like; CKI-alpha-like; casein kinase I alpha S-like
UniProt Protein Name
Casein kinase I isoform alpha-like
Protein Family
UniProt Gene Name
CSNK1A1L
UniProt Synonym Gene Names
CKI-alpha-like
UniProt Entry Name
KC1AL_HUMAN

Uniprot Description

CK1A2: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.

Protein type: Protein kinase, CK1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; CK1 group; CK1 family

Chromosomal Location of Human Ortholog: 13q13.3

Cellular Component: cytoplasm; ribonucleoprotein complex; nucleus

Molecular Function: protein serine/threonine kinase activity; ATP binding

Biological Process: regulation of cell shape; peptidyl-serine phosphorylation; Wnt receptor signaling pathway; cell morphogenesis; phagocytosis

Similar Products

Product Notes

The CSNK1A1L csnk1a1l (Catalog #AAA642178) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSNK1A1L (Casein Kinase I Isoform alpha-like, CKI-alpha-like, CK1, MGC33182, RP11-532O21.2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1A1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CSNK1A1L csnk1a1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTNNSGSKAE LVVGGKYKLV RKIGSGSFGD VYLGITTTNG EEVAVKLESQ KVKHPQLLYE SKLYTILQGG VGIPHMHWYG QEKDNNVLVM DLLGPSLEDL FNFCSRRFTM KTVLMLADQM ISRIEYVHTK NFLHRDIKPD NFLMGTGRHC NKLFLIDFGL AKKYRDNRTR QHIPYREDKH LIGTVRYASI NAHLGIEQSR RDDMESLGYV FMYFNRTSLP WQGLKAMTKK QKYEKISEKK MSTPVEVLCK GFPAEFAMYL NYCRGLRFEE VPDYMYLRQL FRILFRTLNH QYDYTFDWTM LKQKAAQQAA SSSGQGQQAQ TQTGKQTEKN KNNVKDN. It is sometimes possible for the material contained within the vial of "CSNK1A1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.