SDS-PAGE
Casein kinase I isoform alpha-like (CSNK1A1L) Recombinant Protein | CSNK1A1L recombinant protein
Recombinant Human Casein kinase I isoform alpha-like (CSNK1A1L)
Gene Names
CSNK1A1L; CK1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Casein kinase I isoform alpha-like (CSNK1A1L); Recombinant Human Casein kinase I isoform alpha-like (CSNK1A1L); Casein kinase I isoform alpha-like; CKI-alpha-like; EC=2.7.11.1; CK1; CSNK1A1L recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-337aa; Full Length of BC028723
Sequence
MTNNSGSKAELVVGGKYKLVRKIGSGSFGDVYLGITTTNGEEVAVKLESQKVKHPQLLYESKLYTILQGGVGIPHMHWYGQEKDNNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFLHRDIKPDNFLMGTGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKHLIGTVRYASINAHLGIEQSRRDDMESLGYVFMYFNRTSLPWQGLKAMTKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEVPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKDN
Sequence Length
337
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for CSNK1A1L recombinant protein
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66.1 kDa
NCBI Official Full Name
casein kinase I isoform alpha-like
NCBI Official Synonym Full Names
casein kinase 1, alpha 1-like
NCBI Official Symbol
CSNK1A1L
NCBI Official Synonym Symbols
CK1
NCBI Protein Information
casein kinase I isoform alpha-like; CKI-alpha-like; casein kinase I alpha S-like
UniProt Protein Name
Casein kinase I isoform alpha-like
Protein Family
UniProt Gene Name
CSNK1A1L
UniProt Synonym Gene Names
CKI-alpha-like
UniProt Entry Name
KC1AL_HUMAN
Uniprot Description
CK1A2: Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. Casein kinase I subfamily.
Protein type: Protein kinase, CK1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; CK1 group; CK1 family
Chromosomal Location of Human Ortholog: 13q13.3
Cellular Component: cytoplasm; ribonucleoprotein complex; nucleus
Molecular Function: protein serine/threonine kinase activity; ATP binding
Biological Process: regulation of cell shape; peptidyl-serine phosphorylation; Wnt receptor signaling pathway; cell morphogenesis; phagocytosis
Similar Products
Product Notes
The CSNK1A1L csnk1a1l (Catalog #AAA1472531) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-337aa; Full Length of BC028723. The amino acid sequence is listed below: MTNNSGSKAE LVVGGKYKLV RKIGSGSFGD VYLGITTTNG EEVAVKLESQ KVKHPQLLYE SKLYTILQGG VGIPHMHWYG QEKDNNVLVM DLLGPSLEDL FNFCSRRFTM KTVLMLADQM ISRIEYVHTK NFLHRDIKPD NFLMGTGRHC NKLFLIDFGL AKKYRDNRTR QHIPYREDKH LIGTVRYASI NAHLGIEQSR RDDMESLGYV FMYFNRTSLP WQGLKAMTKK QKYEKISEKK MSTPVEVLCK GFPAEFAMYL NYCRGLRFEE VPDYMYLRQL FRILFRTLNH QYDYTFDWTM LKQKAAQQAA SSSGQGQQAQ TQTGKQTEKN KNNVKDN. It is sometimes possible for the material contained within the vial of "Casein kinase I isoform alpha-like (CSNK1A1L), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
