Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CSNK1A1Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CSNK1A1 Polyclonal Antibody | anti-CSNK1A1 antibody

CSNK1A1 Antibody - middle region

Gene Names
CSNK1A1; CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CSNK1A1; Polyclonal Antibody; CSNK1A1 Antibody - middle region; anti-CSNK1A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRR
Sequence Length
325
Applicable Applications for anti-CSNK1A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CSNK1A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CSNK1A1Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CSNK1A1Sample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CSNK1A1 antibody
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis. May play a role in keratin cytoskeleton disassembly and thereby, it may regulate epithelial cell migration.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
casein kinase I isoform alpha isoform 1
NCBI Official Synonym Full Names
casein kinase 1 alpha 1
NCBI Official Symbol
CSNK1A1
NCBI Official Synonym Symbols
CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
NCBI Protein Information
casein kinase I isoform alpha
UniProt Protein Name
Casein kinase I isoform alpha
Protein Family
UniProt Gene Name
CSNK1A1
UniProt Synonym Gene Names
CKI-alpha
UniProt Entry Name
KC1A_HUMAN

Uniprot Description

CK1A: an ubiquitous protein kinase of the CK1 family. Participates in Wnt signaling. Phosphorylates beta catenin, marking it for beta-TRCp-mediated ubiquitinylation and proteasomal degradation.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CK1; EC 2.7.11.1; CK1 group; CK1 family

Chromosomal Location of Human Ortholog: 5q32

Cellular Component: centrosome; membrane; cytoplasm; nuclear speck; mRNA cleavage and polyadenylation specificity factor complex; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding; protein kinase activity

Biological Process: mitosis; regulation of cell shape; peptidyl-serine phosphorylation; cell surface receptor linked signal transduction; Wnt receptor signaling pathway; cell division; signal transduction; protein amino acid phosphorylation; phagocytosis

Research Articles on CSNK1A1

Similar Products

Product Notes

The CSNK1A1 csnk1a1 (Catalog #AAA3223107) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSNK1A1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSNK1A1 csnk1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLFLIDFGLA KKYRDNRTRQ HIPYREDKNL TGTARYASIN AHLGIEQSRR. It is sometimes possible for the material contained within the vial of "CSNK1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.