Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CSGALNACT2Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CSGALNACT2 Polyclonal Antibody | anti-CSGALNACT2 antibody

CSGALNACT2 Antibody - C-terminal region

Gene Names
CSGALNACT2; CHGN2; ChGn-2; PRO0082; GALNACT2; GALNACT-2; beta4GalNAcT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CSGALNACT2; Polyclonal Antibody; CSGALNACT2 Antibody - C-terminal region; anti-CSGALNACT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LYNPAIVYANQEVPPPVEQQLVHKKDSGFWRDFGFGMTCQYRSDFLTIGG
Sequence Length
542
Applicable Applications for anti-CSGALNACT2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CSGALNACT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CSGALNACT2Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CSGALNACT2Sample Type: Thymus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CSGALNACT2 antibody
This is a rabbit polyclonal antibody against CSGALNACT2. It was validated on Western Blot

Target Description: This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. The encoded protein is involved in elongation during chondroitin sulfate synthesis. A related pseudogene has been identified on chromosome X.
Product Categories/Family for anti-CSGALNACT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
chondroitin sulfate N-acetylgalactosaminyltransferase 2 isoform 1
NCBI Official Synonym Full Names
chondroitin sulfate N-acetylgalactosaminyltransferase 2
NCBI Official Symbol
CSGALNACT2
NCBI Official Synonym Symbols
CHGN2; ChGn-2; PRO0082; GALNACT2; GALNACT-2; beta4GalNAcT
NCBI Protein Information
chondroitin sulfate N-acetylgalactosaminyltransferase 2
UniProt Protein Name
Chondroitin sulfate N-acetylgalactosaminyltransferase 2
UniProt Gene Name
CSGALNACT2
UniProt Synonym Gene Names
CHGN2; GALNACT2
UniProt Entry Name
CGAT2_HUMAN

NCBI Description

This gene encodes a member of the chondroitin N-acetylgalactosaminyltransferase family. The encoded protein is involved in elongation during chondroitin sulfate synthesis. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome X. [provided by RefSeq, Feb 2016]

Uniprot Description

GALNACT2: Transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP- GalNAc to the non-reducing end of glucuronic acid (GlcUA). Required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. Belongs to the chondroitin N- acetylgalactosaminyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Glycan Metabolism - chondroitin sulfate biosynthesis; EC 2.4.1.174; Transferase

Chromosomal Location of Human Ortholog: 10q11.21

Cellular Component: Golgi membrane; membrane; integral to Golgi membrane

Molecular Function: metal ion binding; acetylgalactosaminyltransferase activity; glucuronylgalactosylproteoglycan 4-beta-N-acetylgalactosaminyltransferase activity

Biological Process: chondroitin sulfate metabolic process; dermatan sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process; chondroitin sulfate biosynthetic process; glycosaminoglycan metabolic process; proteoglycan biosynthetic process; chondroitin sulfate proteoglycan biosynthetic process; carbohydrate metabolic process; pathogenesis; chondroitin sulfate proteoglycan biosynthetic process, polysaccharide chain biosynthetic process; dermatan sulfate proteoglycan biosynthetic process

Research Articles on CSGALNACT2

Similar Products

Product Notes

The CSGALNACT2 csgalnact2 (Catalog #AAA3209412) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSGALNACT2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CSGALNACT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CSGALNACT2 csgalnact2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LYNPAIVYAN QEVPPPVEQQ LVHKKDSGFW RDFGFGMTCQ YRSDFLTIGG. It is sometimes possible for the material contained within the vial of "CSGALNACT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.