Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Crystallin Alpha B antibody (MBS5301081) used at 5 ug/ml to detect target protein.)

Rabbit anti-Human, Mouse Crystallin Alpha B Polyclonal Antibody | anti-CRYAB antibody

Crystallin Alpha B antibody

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
Crystallin Alpha B; Polyclonal Antibody; Crystallin Alpha B antibody; Polyclonal Crystallin Alpha B; Anti-Crystallin Alpha B; HSPB5; CRYAB; CRYA2; CTPP2; anti-CRYAB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
Crystallin Alpha B antibody was raised against the C terminal of CRYAB
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CRYAB antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
175
Applicable Applications for anti-CRYAB antibody
Western Blot (WB)
Application Notes
WB: 5 ug/ml
Biological Significance
Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.
Cross-Reactivity
Human,Mouse
Immunogen
Crystallin Alpha B antibody was raised using the C terminal of CRYAB corresponding to a region with amino acids  KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Crystallin Alpha B antibody (MBS5301081) used at 5 ug/ml to detect target protein.)

Western Blot (WB) (Crystallin Alpha B antibody (MBS5301081) used at 5 ug/ml to detect target protein.)
Related Product Information for anti-CRYAB antibody
Rabbit polyclonal Crystallin Alpha B antibody raised against the C terminal of CRYAB
Product Categories/Family for anti-CRYAB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12 kDa (MW of target protein)
NCBI Official Full Name
crystallin, alpha B
NCBI Official Symbol
CRYAB
NCBI Protein Information
crystallin, alpha B
Protein Family

Similar Products

Product Notes

The CRYAB (Catalog #AAA5301081) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Crystallin Alpha B antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Crystallin Alpha B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 5 ug/ml. Researchers should empirically determine the suitability of the CRYAB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Crystallin Alpha B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.