Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CRYM expression in transfected 293T cell line by CRYM polyclonal antibody. Lane 1: CRYM transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CRYM Polyclonal Antibody | anti-CRYM antibody

CRYM (Thiomorpholine-carboxylate Dehydrogenase, Mu-crystallin Homolog, NADP-regulated Thyroid-hormone-binding Protein, Ketimine Reductase, THBP) (FITC)

Gene Names
CRYM; THBP; DFNA40
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRYM; Polyclonal Antibody; CRYM (Thiomorpholine-carboxylate Dehydrogenase; Mu-crystallin Homolog; NADP-regulated Thyroid-hormone-binding Protein; Ketimine Reductase; THBP) (FITC); anti-CRYM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CRYM.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-CRYM antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CRYM, aa1-314 (NP_001879.1).
Immunogen Sequence
MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CRYM expression in transfected 293T cell line by CRYM polyclonal antibody. Lane 1: CRYM transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRYM expression in transfected 293T cell line by CRYM polyclonal antibody. Lane 1: CRYM transfected lysate (33.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CRYM antibody
Specifically catalyzes the reduction of imine bonds in brain substrates that may include cystathionine ketimine (CysK) and lanthionine ketimine (LK). Binds thyroid hormone which is a strong reversible inhibitor. Presumably involved in the regulation of the free intracellular concentration of triiodothyronine and access to its nuclear receptors.
Product Categories/Family for anti-CRYM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33,776 Da
NCBI Official Full Name
ketimine reductase mu-crystallin
NCBI Official Synonym Full Names
crystallin, mu
NCBI Official Symbol
CRYM
NCBI Official Synonym Symbols
THBP; DFNA40
NCBI Protein Information
ketimine reductase mu-crystallin; mu-crystallin homolog; thiomorpholine-carboxylate dehydrogenase; NADP-regulated thyroid-hormone binding protein
Protein Family

NCBI Description

Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Mutations in this gene have been associated with autosomal dominant non-syndromic deafness. [provided by RefSeq, Sep 2014]

Research Articles on CRYM

Similar Products

Product Notes

The CRYM (Catalog #AAA6374800) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRYM (Thiomorpholine-carboxylate Dehydrogenase, Mu-crystallin Homolog, NADP-regulated Thyroid-hormone-binding Protein, Ketimine Reductase, THBP) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRYM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRYM for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRYM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.