Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CRHSample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CRH Polyclonal Antibody | anti-CRH antibody

CRH Antibody - C-terminal region

Gene Names
CRH; CRF; CRH1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRH; Polyclonal Antibody; CRH Antibody - C-terminal region; anti-CRH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLM
Sequence Length
196
Applicable Applications for anti-CRH antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CRH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CRHSample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CRHSample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CRH antibody
This is a rabbit polyclonal antibody against CRH. It was validated on Western Blot

Target Description: Corticotropin-releasing hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in this protein has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition.
Product Categories/Family for anti-CRH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
corticoliberin preproprotein
NCBI Official Synonym Full Names
corticotropin releasing hormone
NCBI Official Symbol
CRH
NCBI Official Synonym Symbols
CRF; CRH1
NCBI Protein Information
corticoliberin
UniProt Protein Name
Corticoliberin
Protein Family
UniProt Gene Name
CRH
UniProt Synonym Gene Names
CRF
UniProt Entry Name
CRF_HUMAN

NCBI Description

This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition. [provided by RefSeq, Nov 2015]

Uniprot Description

CRH: This hormone from hypothalamus regulates the release of corticotropin from pituitary gland. Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 8q13

Cellular Component: extracellular space; cytoplasm; extracellular region; perikaryon

Molecular Function: corticotropin-releasing hormone receptor 1 binding; neuropeptide hormone activity; protein binding; hormone activity; corticotropin-releasing hormone receptor 2 binding; adrenocorticotropin-releasing hormone activity; receptor binding

Biological Process: diterpenoid metabolic process; negative regulation of circadian sleep/wake cycle, REM sleep; synaptic transmission, dopaminergic; hypothalamus development; positive regulation of cortisol secretion; induction of apoptosis by hormones; response to pain; female pregnancy; signal transduction; positive regulation of adrenocorticotropic hormone secretion; negative regulation of luteinizing hormone secretion; synaptic transmission; learning and/or memory; positive regulation of cAMP biosynthetic process; positive regulation of cell proliferation; feeding behavior; parturition; negative regulation of blood pressure; inflammatory response; response to electrical stimulus; associative learning; response to corticosterone stimulus; response to drug; adrenal gland development; response to ether; response to ethanol; long-term memory; ion homeostasis; response to estrogen stimulus; regulation of serotonin secretion; negative regulation of epinephrine secretion; positive regulation of protein amino acid phosphorylation; glucocorticoid biosynthetic process; lung development

Disease: Acth Deficiency, Isolated

Research Articles on CRH

Similar Products

Product Notes

The CRH crh (Catalog #AAA3206039) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRH Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRH crh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGHQEAPERE RRSEEPPISL DLTFHLLREV LEMARAEQLA QQAHSNRKLM. It is sometimes possible for the material contained within the vial of "CRH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.