Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TBX6 is approximately 0.3ng/ml as a capture antibody.)

Mouse TBX6 Monoclonal Antibody | anti-TBX6 antibody

TBX6 (T-Box 6, DFNB67) (APC)

Gene Names
TBX6; SCDO5
Applications
ELISA
Purity
Purified
Synonyms
TBX6; Monoclonal Antibody; TBX6 (T-Box 6; DFNB67) (APC); T-Box 6; DFNB67; anti-TBX6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D6
Specificity
Recognizes TBX6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TBX6 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TBX6 (NP_004599, 191aa-299aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TBX6 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TBX6 is approximately 0.3ng/ml as a capture antibody.)
Related Product Information for anti-TBX6 antibody
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. [provided by RefSeq]
Product Categories/Family for anti-TBX6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
T-box transcription factor TBX6
NCBI Official Synonym Full Names
T-box 6
NCBI Official Symbol
TBX6
NCBI Official Synonym Symbols
SCDO5
NCBI Protein Information
T-box transcription factor TBX6
UniProt Protein Name
T-box transcription factor TBX6
UniProt Gene Name
TBX6
UniProt Synonym Gene Names
T-box protein 6
UniProt Entry Name
TBX6_HUMAN

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. [provided by RefSeq, Aug 2008]

Uniprot Description

TBX6: T-box transcription factor that plays an essential role in the determination of the fate of axial stem cells: neural vs mesodermal. Acts in part by down-regulating, a specific enhancer (N1) of SOX2, to inhibit neural development. Seems to play also an essential role in left/right axis determination and acts through effects on Notch signaling around the node as well as through an effect on the morphology and motility of the nodal cilia.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleus

Molecular Function: DNA binding; transcription factor activity

Biological Process: negative regulation of neuron maturation; anatomical structure morphogenesis; transcription, DNA-dependent; mesoderm formation; positive regulation of transcription from RNA polymerase II promoter; cell fate specification; mesoderm development; negative regulation of transcription from RNA polymerase II promoter; somite rostral/caudal axis specification

Disease: Deafness, Autosomal Recessive 67

Research Articles on TBX6

Similar Products

Product Notes

The TBX6 tbx6 (Catalog #AAA6167573) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TBX6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TBX6 tbx6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBX6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.