Western Blot (WB)
(WB Suggested Anti-CPXCR1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Rabbit anti-Human CPXCR1 Polyclonal Antibody | anti-CPXCR1 antibody
CPXCR1 antibody - N-terminal region
Gene Names
CPXCR1; CT77
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
CPXCR1; Polyclonal Antibody; CPXCR1 antibody - N-terminal region; anti-CPXCR1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATS
Sequence Length
301
Applicable Applications for anti-CPXCR1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CPXCR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CPXCR1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-CPXCR1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-CPXCR1 antibody
This is a rabbit polyclonal antibody against CPXCR1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function remains unknown.
Target Description: The function remains unknown.
Product Categories/Family for anti-CPXCR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35kDa
NCBI Official Full Name
CPX chromosomal region candidate gene 1 protein
NCBI Official Synonym Full Names
CPX chromosome region candidate 1
NCBI Official Symbol
CPXCR1
NCBI Official Synonym Symbols
CT77
NCBI Protein Information
CPX chromosomal region candidate gene 1 protein
Protein Family
NCBI Description
This gene is one of several genes identified in a region of the X chromosome associated with an X-linked cleft palate (CPX) disorder. The encoded protein contains a motif similar to a motif found in zinc-finger proteins. Mutation analysis of this gene has not revealed any mutation which causes the CPX disorder. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2011]
Research Articles on CPXCR1
Similar Products
Product Notes
The CPXCR1 (Catalog #AAA3204816) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPXCR1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CPXCR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CPXCR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDTAGNAHKN SENEPPNDCS TDIESPSADP NMIYQVETNP INREPGTATS. It is sometimes possible for the material contained within the vial of "CPXCR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
