Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-COX6A1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCOX6A1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit anti-Human COX6A1 Polyclonal Antibody | anti-COX6A1 antibody

COX6A1 antibody - N-terminal region

Gene Names
COX6A1; COX6A; CMTRID; COX6AL
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COX6A1; Polyclonal Antibody; COX6A1 antibody - N-terminal region; anti-COX6A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAV
Sequence Length
109
Applicable Applications for anti-COX6A1 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-COX6A1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCOX6A1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-COX6A1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellCOX6A1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-COX6A1 antibody
This is a rabbit polyclonal antibody against COX6A1. It was validated on Western Blot

Target Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
cytochrome c oxidase subunit 6A1, mitochondrial
NCBI Official Synonym Full Names
cytochrome c oxidase subunit 6A1
NCBI Official Symbol
COX6A1
NCBI Official Synonym Symbols
COX6A; CMTRID; COX6AL
NCBI Protein Information
cytochrome c oxidase subunit 6A1, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 6A1, mitochondrial
Protein Family
UniProt Gene Name
COX6A1
UniProt Synonym Gene Names
COX6AL; COX VIa-L
UniProt Entry Name
CX6A1_HUMAN

NCBI Description

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented. [provided by RefSeq, Jul 2008]

Uniprot Description

COX6A1: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Belongs to the cytochrome c oxidase subunit 6A family.

Protein type: Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 12q24.2|12q24.2

Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex IV

Molecular Function: cytochrome-c oxidase activity

Biological Process: cellular metabolic process; generation of precursor metabolites and energy; transmembrane transport

Disease: Charcot-marie-tooth Disease, Recessive Intermediate D

Research Articles on COX6A1

Similar Products

Product Notes

The COX6A1 cox6a1 (Catalog #AAA3208211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COX6A1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COX6A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COX6A1 cox6a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVGVSSVSRL LGRSRPQLGR PMSSGAHGEE GSARMWKTLT FFVALPGVAV. It is sometimes possible for the material contained within the vial of "COX6A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.